CX671840

Overview
NameCX671840
Unique NameCX671840
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length924
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5102 contig Csv1_Contig5102:128..1053. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1B3_ARATH (PRA1 family protein B3 OS=Arabidopsis thaliana GN=PRA1B3 PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.218e-43
Identity = 86/147 (58.50%), Postives = 95/147 (64.63%), Query Frame = -3
Query:  419 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPIN 859
            LSQRR W ELVDR+A+SRP+SL +AYSRIR+NL YFKVNYVT                         AWIFLYLFRPSDQP+V+ GRTFSDRE                 VGSLL SALM+G  IVC HGAFRVPEDLFLD+QEP N
Sbjct:   44 LSQRRPWLELVDRSAISRPESLTDAYSRIRRNLPYFKVNYVTIVSLVLALSLLSHPFSLLVLLCLFCAWIFLYLFRPSDQPLVVLGRTFSDRETLGVLVILTIVVVFLTSVGSLLTSALMIGFGIVCLHGAFRVPEDLFLDDQEPAN 190          

HSP 2 Score: 36.1946 bits (82), Expect = 2.218e-43
Identity = 16/19 (84.21%), Postives = 18/19 (94.74%), Query Frame = -1
Query:  865 PIATPAFRAFLSRLSSSIR 921
            P++TPAFR FLSRLSSSIR
Sbjct:   23 PVSTPAFRTFLSRLSSSIR 41          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1B1_ARATH (PRA1 family protein B1 OS=Arabidopsis thaliana GN=PRA1B1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.417e-42
Identity = 84/147 (57.14%), Postives = 97/147 (65.99%), Query Frame = -3
Query:  419 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPIN 859
            LSQRR W+EL+DR++M+RP+SL +A SRIRKNL+YFKVNYV                        LG W+FLYLFRPSDQP+V+FGRTFSDRE                 VGSLL SALM+G AIVC HGAF VP+DLFLDEQEP N
Sbjct:   41 LSQRRPWTELIDRSSMARPESLTDALSRIRKNLAYFKVNYVAIVSLVLAFSLFSHPLSLLVLIGLLGGWMFLYLFRPSDQPLVVFGRTFSDRETLLALVLSTIVVVFMTSVGSLLTSALMIGVAIVCVHGAFVVPDDLFLDEQEPAN 187          

HSP 2 Score: 33.8834 bits (76), Expect = 1.417e-42
Identity = 16/21 (76.19%), Postives = 17/21 (80.95%), Query Frame = -1
Query:  859 PIATPAFRAFLSRLSSSIRYG 921
            PI TPAFR F SRLS+SIR G
Sbjct:   20 PINTPAFRTFFSRLSTSIRDG 40          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1B2_ARATH (PRA1 family protein B2 OS=Arabidopsis thaliana GN=PRA1B2 PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.797e-39
Identity = 82/147 (55.78%), Postives = 95/147 (64.63%), Query Frame = -3
Query:  419 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPIN 859
            LSQRR W ELVDR++ +RPDSL +++SRIRKNL+YFKVNY                         LG+W+FLYLFR SDQP+VLFGR+FSDRE                 VGSLL SAL +G AIVC HGAFRVP+DLFLDEQEP N
Sbjct:   43 LSQRRPWLELVDRSSFARPDSLTDSFSRIRKNLAYFKVNYSAIVSLVLAFSLLSHPFSLLVLLSLLGSWMFLYLFRSSDQPLVLFGRSFSDRETLLGLVLTTIVVVFMTSVGSLLTSALTIGIAIVCLHGAFRVPDDLFLDEQEPAN 189          

HSP 2 Score: 29.6462 bits (65), Expect = 1.797e-39
Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = -1
Query:  865 PIATPAFRAFLSRLSSSIR 921
            PI + AFR FLSRLSSS+R
Sbjct:   22 PINSHAFRTFLSRLSSSLR 40          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1B4_ARATH (PRA1 family protein B4 OS=Arabidopsis thaliana GN=PRA1B4 PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.340e-39
Identity = 77/145 (53.10%), Postives = 97/145 (66.90%), Query Frame = -3
Query:  425 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEP 859
            LS+RR W+EL DR+A+S+P+S+++A  RIRKN SYFKVNY+T                       L +W+FLYLFRP+DQP+VLFGRTFSDRE                 VGS+L+SA+M+G A++CAHGAFR PEDLFLDEQEP
Sbjct:   51 LSKRRPWAELADRSALSKPESISDAAVRIRKNYSYFKVNYLTVATAIVGFSLVTHPFSLVFLLCLLASWLFLYLFRPTDQPIVLFGRTFSDRETLGCLILFSIFVIFLTDVGSVLVSAMMIGVALICAHGAFRAPEDLFLDEQEP 195          

HSP 2 Score: 28.8758 bits (63), Expect = 2.340e-39
Identity = 10/21 (47.62%), Postives = 18/21 (85.71%), Query Frame = -1
Query:  859 PIATPAFRAFLSRLSSSIRYG 921
            PIATPAFR F+++++ +++ G
Sbjct:   30 PIATPAFRNFINQITETVKNG 50          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1B5_ARATH (PRA1 family protein B5 OS=Arabidopsis thaliana GN=PRA1B5 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.066e-32
Identity = 70/144 (48.61%), Postives = 90/144 (62.50%), Query Frame = -3
Query:  428 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQE 859
            LS+ R WSEL+DR+A ++PDSL+EA +R RKN SYF+VNYV                          +W+FLYLFRPSD+P++LFGR+FS+ E                 VGS+LISALM+G A +C HGAFR P+DLFLDEQ+
Sbjct:   51 LSRSRPWSELLDRSAFTKPDSLSEAGTRFRKNSSYFRVNYVCIVALILGFSLLAHPFSLILLLCLAASWLFLYLFRPSDRPLILFGRSFSEYETLGGLILSTIAVIFFTSVGSVLISALMIGIATICVHGAFRAPDDLFLDEQD 194          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1B6_ARATH (PRA1 family protein B6 OS=Arabidopsis thaliana GN=PRA1B6 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.806e-29
Identity = 69/142 (48.59%), Postives = 82/142 (57.75%), Query Frame = -3
Query:  422 RHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQEPI 847
            R W+ELVDR+A SRP SL+EA SR+RKN SYF+ NY+T                         +W+FLY FRP+DQP+V+ GRTFSD E                 VGSLL+S L VG   V  HGAFR PEDLFL+EQE I
Sbjct:   45 RPWAELVDRSAFSRPPSLSEATSRVRKNFSYFRANYITLVAILLAASLLTHPFALFLLASLAASWLFLYFFRPADQPLVIGGRTFSDLETLGILCLSTVVVMFMTSVGSLLMSTLAVGIMGVAIHGAFRAPEDLFLEEQEAI 186          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PRA1E_ARATH (PRA1 family protein E OS=Arabidopsis thaliana GN=PRA1E PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.553e-11
Identity = 41/139 (29.50%), Postives = 63/139 (45.32%), Query Frame = -3
Query:  431 RHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQ 847
            R W E++D +A+S P    EA + ++ N+SYF+ NY                            WI LY  R ++  +V+ G+   D+                  VG  ++ +L++G  IV AHGAFR  +DLFLDE+
Sbjct:   48 RPWREILDLSALSLPRGYDEAMAHLKHNISYFRGNYALAVLAIVFLGLIYHPMSMIAFIVVFIGWILLYFSRDANDSIVISGKEVDDKIVLVLLSLVTVLALVYTDVGENVLVSLIIGLLIVGAHGAFRNTDDLFLDEE 186          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1F3_ARATH (PRA1 family protein F3 OS=Arabidopsis thaliana GN=PRA1F3 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.029e-11
Identity = 42/143 (29.37%), Postives = 62/143 (43.36%), Query Frame = -3
Query:  431 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQ 859
            L+ RR W  + D  +M  P  +++A++RI+ NL+YF++NY                         +  WIFLY  R  D+P+ LF     DR                      ++ AL+ GA +V  H   R  EDLFLDE+
Sbjct:   33 LATRRAWRVMFDFHSMGLPHGVSDAFTRIKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLR--DEPIKLFRFQIDDRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEE 173          
BLAST of CX671840 vs. ExPASy Swiss-Prot
Match: PR1F2_ARATH (PRA1 family protein F2 OS=Arabidopsis thaliana GN=PRA1F2 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.460e-11
Identity = 42/143 (29.37%), Postives = 61/143 (42.66%), Query Frame = -3
Query:  431 LSQRRHWSELVDRTAMSRPDSLAEAYSRIRKNLSYFKVNYVTXXXXXXXXXXXXXXXXXXXXXXXLGAWIFLYLFRPSDQPVVLFGRTFSDREXXXXXXXXXXXXXXXXXVGSLLISALMVGAAIVCAHGAFRVPEDLFLDEQ 859
            L+ RR W  + D  +M+ P    +A SRI+ NL YF+ NY                         +  WIFLY  R  D+P+V+FG    DR                    S ++ +L+  A +V  H A R  ++LFLDE+
Sbjct:   33 LATRRPWKSMFDFESMTLPHGFFDAISRIKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLR--DEPLVVFGYQIDDRTVLIGLSVLTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEE 173          
The following BLAST results are available for this feature:
BLAST of CX671840 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
PR1B3_ARATH2.218e-4358.50PRA1 family protein B3 OS=Arabidopsis thaliana GN=... [more]
PR1B1_ARATH1.417e-4257.14PRA1 family protein B1 OS=Arabidopsis thaliana GN=... [more]
PR1B2_ARATH1.797e-3955.78PRA1 family protein B2 OS=Arabidopsis thaliana GN=... [more]
PR1B4_ARATH2.340e-3953.10PRA1 family protein B4 OS=Arabidopsis thaliana GN=... [more]
PR1B5_ARATH6.066e-3248.61PRA1 family protein B5 OS=Arabidopsis thaliana GN=... [more]
PR1B6_ARATH4.806e-2948.59PRA1 family protein B6 OS=Arabidopsis thaliana GN=... [more]
PRA1E_ARATH1.553e-1129.50PRA1 family protein E OS=Arabidopsis thaliana GN=P... [more]
PR1F3_ARATH2.029e-1129.37PRA1 family protein F3 OS=Arabidopsis thaliana GN=... [more]
PR1F2_ARATH3.460e-1129.37PRA1 family protein F2 OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_13D12_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-13D12-G23-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671840 ID=CX671840|Name=CX671840|organism=Citrus sinensis|type=EST|length=924bp
TTTTTTTAAGTAAACATTCCTGCAAATTCCATTATTCAAGTTAAGGAAAC
AGTAAATCACAAAGAATGAATTAACACAAAATTGATCACAGACAAGCAAA
GAATATGAACAGTCCTAGCTAAAGATCCTGCAGAAAGATCCACAAAATGA
ACGATCCACATTGAATTCGCGATTACACTAAAAATATTGAACATCTAGCA
TGTAACAAAATTGAAATCATACAAATCAAACATAGAGATCCAAAATGTTA
CATTTAAGAGTAGGAAACAAAACCCTAAATCAATTCCTTTCCCTAAAAAG
AATCATGAATTAATCATACGCTTGATCATTGACGATCCGGCGAGTCATTT
CAGACACGTGCCGCAACCGAGGGGGCAGCGGCGGATGCGGCGCCACCGAG
GAACGACAGGAATCCGGAATTGATGGGCTCTTGCTCGTCCAAAAACAGAT
CCTCAGGAACCCTAAACGCACCATGCGCACACACGATCGCAGCTCCGACC
ATCAACGCTGAGATCAACAAGGATCCGACGCTGGTCAAGAACACGACAAC
GATAGTCAAAACGACAAGAGCGCCGAGCGTTTCGCGGTCGGAAAACGTAC
GGCCAAAGAGGACCACGGGTTGATCGGAAGGGCGGAAGAGGTAGAGGAAG
ATCCAAGCGCCTAGGAGGCAGAGCAGGACGAGGAGAGAGAAAGGATGGGA
CAGGAGAGAGAATGCGAGTACGAGGCCGAGTAAAGTTACGTAATTGACCT
TGAAGTAGGAGAGGTTCTTTCGGATCCGAGAGTACGCTTCGGCTAAGGAG
TCGGGTCGGGACATGGCGGTTCGGTCAACGAGTTCGGACCAGTGGCGTCT
CTGAGAGAGCCATAACGGATCGAAGAGGAGAGGCGTGACAGGAACGCGCG
GAAGGCGGGCGTGGCGATGGGTGC
back to top