DT214566

Overview
NameDT214566
Unique NameDT214566
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length861
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB7_ARATH (Tubulin beta-7 chain OS=Arabidopsis thaliana GN=TUBB7 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.679e-65
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB2_ORYSJ (Tubulin beta-2 chain OS=Oryza sativa subsp. japonica GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.679e-65
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB2_ARATH (Tubulin beta-2/beta-3 chain OS=Arabidopsis thaliana GN=TUBB2 PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.679e-65
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB8_ARATH (Tubulin beta-8 chain OS=Arabidopsis thaliana GN=TUBB8 PE=2 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 2.863e-65
Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQM+NVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB2_LUPAL (Tubulin beta-2 chain OS=Lupinus albus GN=TUBB2 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.863e-65
Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQM+NVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB1_LUPAL (Tubulin beta-1 chain OS=Lupinus albus GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.863e-65
Identity = 121/122 (99.18%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQM+NVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB1_PEA (Tubulin beta-1 chain OS=Pisum sativum GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 6.379e-65
Identity = 120/122 (98.36%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQM+NVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV+EYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMMNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB2_PEA (Tubulin beta-2 chain (Fragment) OS=Pisum sativum GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 8.331e-65
Identity = 120/122 (98.36%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASA+FRGKMSTKEVDEQM+NVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  307 RYLTASAIFRGKMSTKEVDEQMMNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 428          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB1_MAIZE (Tubulin beta-1 chain OS=Zea mays GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.088e-64
Identity = 121/122 (99.18%), Postives = 121/122 (99.18%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPP GLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPHGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DT214566 vs. ExPASy Swiss-Prot
Match: TBB2_SOYBN (Tubulin beta-2 chain OS=Glycine max GN=TUBB2 PE=3 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.424e-64
Identity = 119/122 (97.54%), Postives = 122/122 (100.00%), Query Frame = -2
Query:  255 RYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 620
            RYLTASAMFRGKMSTKEVDEQM+NVQNKNSSYFVEWIP+NVKSTVCDIPPTGL+MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  309 RYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPHNVKSTVCDIPPTGLRMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of DT214566 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 375
Match NameE-valueIdentityDescription
TBB7_ARATH1.679e-65100.00Tubulin beta-7 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB2_ORYSJ1.679e-65100.00Tubulin beta-2 chain OS=Oryza sativa subsp. japoni... [more]
TBB2_ARATH1.679e-65100.00Tubulin beta-2/beta-3 chain OS=Arabidopsis thalian... [more]
TBB8_ARATH2.863e-6599.18Tubulin beta-8 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB2_LUPAL2.863e-6599.18Tubulin beta-2 chain OS=Lupinus albus GN=TUBB2 PE=... [more]
TBB1_LUPAL2.863e-6599.18Tubulin beta-1 chain OS=Lupinus albus GN=TUBB1 PE=... [more]
TBB1_PEA6.379e-6598.36Tubulin beta-1 chain OS=Pisum sativum GN=TUBB1 PE=... [more]
TBB2_PEA8.331e-6598.36Tubulin beta-2 chain (Fragment) OS=Pisum sativum G... [more]
TBB1_MAIZE1.088e-6499.18Tubulin beta-1 chain OS=Zea mays GN=TUBB1 PE=2 SV=... [more]
TBB2_SOYBN2.424e-6497.54Tubulin beta-2 chain OS=Glycine max GN=TUBB2 PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_22C01_b2 Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10-2 Citrus sinensis cDNA clone UCRCS10-22C01-E2-5.d-polyt, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DT214566 ID=DT214566|Name=DT214566|organism=Citrus sinensis|type=EST|length=861bp
GATTCCAAAGCAAATTGAAGTATCATATTTAAACATACAAGGTTCCAAGA
AAATTAAACAATAAGGGGAAAAGGACGAAAAGATGAAGAAACTATTTCAA
TTAGGCTTCTCCGCTTCTATCTAGATCATGACAAGAAACCAGCAACTGGA
AGTTGAGGTTCCAAAGAATTGCTTCAGAAGCAATCCACCCATCAAAATTA
TTGCTGATAGTCTTCATCAAACTGTTCCTCTTCATCATCATATCCTTCCT
CATCAGCTGTTGCATCTTGGTATTGCTGATACTCTGAAACCAAATCATTC
ATGTTGCTCTCTGCCTCAGTGAACTCCATCTCATCCATACCTTCCCCAGT
ATACCAATGTAAGAAAGCTTTTCTCCTAAACATGGCAGTAAATTGTTCAC
TCACACGCCTGAACATTTCCTGGATAGATGTGGAGTTCCCAATGAACGTG
GAGGCCATCTTCAAACCAGTGGGTGGGATATCACAAACGGTAGACTTCAC
ATTGTTGGGGATCCACTCAACAAAGTATGAGGAGTTCTTGTTCTGAACAT
TCAGCATTTGCTCATCTACTTCCTTGGTGCTCATCTTACCACGGAACATG
GCTGATGCTGTTAGATAGCGGCGTGAGTTTTGAACCTCAGATATTCAATT
TATTCTCTTGAAAAGTAAAAATAAAGATTGAACTCAAATGCACTGAAGCT
CTGATATTTACATAATTATAAACACGAATGTCAATATGTATGCCAGCAGA
CCAACAGACCTTGATAATCTCCTCTCCCCTGCGCCTGCGGTAGTATCTGT
TTTGATCATGATCCTGAATAGGCAATCCCCTGTGGATGGATTTGTGGTGG
TAACAGCCGAA
back to top