CN189360

Overview
NameCN189360
Unique NameCN189360
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN189360_ssr91 microsatellite CN189360_ssr91:91..102. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CN189360 vs. ExPASy Swiss-Prot
Match: DHX8_ARATH (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 5.244e-25
Identity = 62/110 (56.36%), Postives = 72/110 (65.45%), Query Frame = 3
Query:  273 LKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPPXXXXXXXXXXXXXXXXXXXXXXXXLAIEDSRDKVKD 602
            L KL + SLVS VC+ELETHLG  +KVLAEFI +LGR+ ETVDEFD  LKE GAEMPDYFVR+LLT IH I PP                        LAI+D++DKVK+
Sbjct:    6 LNKLNHLSLVSNVCNELETHLGSAEKVLAEFIIDLGRHSETVDEFDKNLKEAGAEMPDYFVRSLLTTIHGIYPP------KPKSEKKKEEGDDQKFKGLAIKDTKDKVKE 109          
BLAST of CN189360 vs. ExPASy Swiss-Prot
Match: DHX8_MOUSE (ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.164e-14
Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  255 PASDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPP 494
            P   + L KLEY SLVSKVC+EL+ HLG  DK LAEF+  L     T D F + L +NGAE  D  +  LL +I  + PP
Sbjct:   16 PGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPP 95          
BLAST of CN189360 vs. ExPASy Swiss-Prot
Match: DHX8_HUMAN (ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.164e-14
Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 3
Query:  255 PASDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDSKLKENGAEMPDYFVRTLLTIIHAILPP 494
            P   + L KLEY SLVSKVC+EL+ HLG  DK LAEF+  L     T D F + L +NGAE  D  +  LL +I  + PP
Sbjct:   16 PGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPP 95          
The following BLAST results are available for this feature:
BLAST of CN189360 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
DHX8_ARATH5.244e-2556.36Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
DHX8_MOUSE4.164e-1448.75ATP-dependent RNA helicase DHX8 OS=Mus musculus GN... [more]
DHX8_HUMAN4.164e-1448.75ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN... [more]
back to top
Libraries
Library NameType
Washington Navel Orange Stored Fruit Rind cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS06_0001L18_r Washington Navel Orange Stored Fruit Rind cDNA Library Citrus sinensis cDNA clone CS_WEc0001L18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN189360 ID=CN189360|Name=CN189360|organism=Citrus sinensis|type=EST|length=651bp
ACCTTTTCACTCTTAAAACAAATGGGAAATTTTAAGCCGACATCCATGGC
AACAGCCATTGTCTCCGCGGCCTATTTGTCTTTGTTGTTGTTATTATTAT
TATTTATTCAAAAATAAATATTAATTAACGTTATTCTTCTGATAGCGCAG
GCACAACAAAAATCTGGAATTTGTCGATAGTGGACATGTAAATCAGGTAC
TCGAAAACCCTAATTCTGTTATTTGTATTTCGAACAACGAAAACGATGGA
TCCTCCAGCCTCAGACGATGGTCTAAAGAAATTAGAGTACTTTTCTCTTG
TCTCTAAAGTCTGTTCCGAGTTAGAAACTCATCTAGGGTTCGGGGACAAA
GTTTTAGCGGAGTTCATAACCGAGTTGGGTCGTAACTGCGAAACTGTTGA
TGAATTTGATTCTAAACTGAAAGAAAACGGCGCCGAGATGCCTGATTATT
TTGTCCGTACATTATTGACTATCATCCACGCCATTCTTCCACCGAAGTCG
AAATCAGCAGATAAAGAATCAAAAAAAGAGGGTGGTGGTGATGGTAAAAA
AACAAAGTTCAAGGCTCTTGCTATAGAAGATAGTAGGGATAAAGTCAAAG
ACCTTGAGAGAGAACTTGAAGCTGAGGCACGTGAGCGGCCGGAAAGGAAA
T
back to top