CX288253
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288253 vs. ExPASy Swiss-Prot
Match: MCCA_SOYBN (Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13 Identity = 34/45 (75.56%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 1 GQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQ 135 GQP+LVLEAMKMEHVVKAP++G VHGLQ+ G+QVSDGSVLF ++ Sbjct: 685 GQPVLVLEAMKMEHVVKAPSSGYVHGLQLMVGEQVSDGSVLFSVK 729
BLAST of CX288253 vs. ExPASy Swiss-Prot
Match: MCCA_ARATH (Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 4.246e-13 Identity = 35/46 (76.09%), Postives = 41/46 (89.13%), Query Frame = 1 Query: 1 GQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQG 138 GQPILVLEAMKMEHVVKAP++G + L+V AGQQVSDGS LFR++G Sbjct: 689 GQPILVLEAMKMEHVVKAPSSGSIQDLKVKAGQQVSDGSALFRIKG 734
BLAST of CX288253 vs. ExPASy Swiss-Prot
Match: MCCA_ORYSJ (Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 5.190e-11 Identity = 31/45 (68.89%), Postives = 37/45 (82.22%), Query Frame = 1 Query: 1 GQPILVLEAMKMEHVVKAPTTGVVHGLQVTAGQQVSDGSVLFRLQ 135 GQP++V+EAMKMEHVVKAP G V GL+ TAGQQV D SVLF ++ Sbjct: 688 GQPVMVMEAMKMEHVVKAPCAGYVEGLKATAGQQVFDSSVLFTVK 732 The following BLAST results are available for this feature:
BLAST of CX288253 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288253 ID=CX288253; Name=CX288253; organism=Citrus clementina; type=EST; length=444bpback to top |