CX288532

Overview
NameCX288532
Unique NameCX288532
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length592
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig483 contig Ccv1_Contig483:35..626. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_ERWCT (Bifunctional polymyxin resistance protein arnA OS=Erwinia carotovora subsp. atroseptica GN=arnA PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.062e-35
Identity = 78/181 (43.09%), Postives = 108/181 (59.67%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVY--AKVSGEAALEEPTVDVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A GA+NGL FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KLVDGG  +R F  I D IEA+  +IEN   + +G I N+GNPHNE ++R+L EM+   +    +          +DV S  +YG+GY D   R P +
Sbjct:  453 EDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAKNGLRFTLFRPFNWMGPRLD---TLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDIHDGIEALFRVIENRNGQCDGQIINIGNPHNEASIRELGEMLLTSFNAHPLRDRFPPFAGFIDVESSSYYGKGYQDVAHRTPSI 630          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_YERE8 (Bifunctional polymyxin resistance protein arnA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=arnA PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.303e-34
Identity = 78/183 (42.62%), Postives = 110/183 (60.11%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAKVSGEAALEEPTV----DVSSKEFYGEGYDDSDKRIPDM 574
            ED+S  I G I KQRW Y+ +KQL++R+I+A GA+  L+FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KLVDGG+ +R F  I D IEA+  +IEN     +G I N+GNP NE ++R+LAEM+   + K   E     P      D+ S  +YG+GY D + R P +
Sbjct:  446 EDSSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAKENLKFTLFRPFNWMGPRLD---NLDAARIGSSRAITQLILNLVEGSPIKLVDGGEQKRCFTDIHDGIEALFRIIENRDGACDGQIINIGNPTNEASIRELAEMLLRCFEK--HELRHNFPPFAGFKDIESSAYYGKGYQDVEYRTPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_PROMH (Bifunctional polymyxin resistance protein arnA OS=Proteus mirabilis (strain HI4320) GN=arnA PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.303e-34
Identity = 76/181 (41.99%), Postives = 111/181 (61.33%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAK--VSGEAALEEPTVDVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A GA+ GL+FT+ RPFNW+GPR+D    ++    G  R +     NL+   P+KLVDGG+ +R F  I D IEA+  +IEN   + +G I N+GNP NE ++R+LAEM+ + + K  + G          + S  +YG+GY D + R P +
Sbjct:  446 EDNSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAKEGLKFTLFRPFNWMGPRLD---NLNSARIGSSRAITQLILNLVEGSPIKLVDGGEQKRCFTDINDGIEALFRIIENRDNKCDGQIINIGNPTNEASIRELAEMLLDCFEKHELRGHFPPFAGFKKIESSSYYGKGYQDVEHRKPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_PECCP (Bifunctional polymyxin resistance protein arnA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=arnA PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.929e-34
Identity = 76/181 (41.99%), Postives = 108/181 (59.67%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVY--AKVSGEAALEEPTVDVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A GA+NGL FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KLVDGG  +R F  I D IEA+  +IEN   + +G I N+GNPHNE ++R+L +M+   +    +          ++V S  +YG+GY D   R P +
Sbjct:  452 EDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAKNGLRFTLFRPFNWMGPRLD---TLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDIHDGIEALFRIIENRNGQCDGQIINIGNPHNEASIRELGDMLLTSFNAHPLRDRFPPFAGFIEVESSSYYGKGYQDVAHRTPSI 629          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_SERP5 (Bifunctional polymyxin resistance protein arnA OS=Serratia proteamaculans (strain 568) GN=arnA PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 8.753e-34
Identity = 77/181 (42.54%), Postives = 108/181 (59.67%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAK--VSGEAALEEPTVDVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A GA+ GL+FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KL+DGG  +R F  I D IEA+  +IEN     +G I N+GNP NE ++R+LAEM+ E +    +           DV S  +YG+GY D + R P +
Sbjct:  446 EDHSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAKEGLKFTLFRPFNWMGPRLD---NLDAARIGSSRAITQLILNLVEGSPIKLMDGGAQKRCFTDINDGIEALFRIIENRDGLCDGQIVNIGNPTNEASIRELAEMLLESFNNHPLRDRFPPFAGFKDVESSSYYGKGYQDVEHRTPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_KLEP7 (Bifunctional polymyxin resistance protein arnA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=arnA PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.547e-33
Identity = 72/181 (39.78%), Postives = 112/181 (61.88%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAK--VSGEAALEEPTVDVSSKEFYGEGYDDSDKRIPDM 574
            ED+S  + G I KQRW Y+ +KQL++R+I+A G +NGL+FT+ RPFNW+GPR+D    ++    G  R +     NL+   P+KL++GG+ +R F  I D IEA+  +IEN   R +G I N+GNP NE ++++LAEM+   + +  +           +V S ++YG+GY D + R P +
Sbjct:  446 EDSSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDKNGLKFTLFRPFNWMGPRLD---NLNAARIGSSRAITQLILNLVEGSPIKLIEGGKQKRCFTDISDGIEALFRIIENKDGRCDGQIINIGNPDNEASIKELAEMLLACFERHPLRDRFPPFAGFREVESSDYYGKGYQDVEHRKPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_ERWT9 (Bifunctional polymyxin resistance protein arnA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=arnA PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.326e-33
Identity = 73/181 (40.33%), Postives = 110/181 (60.77%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIENPAR-ANGHIFNVGNPHNEVTVRQLAEMMTEVYAK--VSGEAALEEPTVDVSSKEFYGEGYDDSDKRIPDM 574
            ED+S  + G I KQRW Y+ +KQL++R+I+A G + GL FT+ RPFNW+GPR+D    ++    G  R +     NL+   P+KL+DGG+ +R F  I D IEA+ L+IEN  +  +G I N+GNP NE +++QLAE + E + +  +           +V S  +YG+GY D + R P +
Sbjct:  446 EDSSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDKEGLRFTLFRPFNWMGPRLD---NLNAARIGSSRAITQLILNLVEGSPIKLIDGGRQKRCFTDIHDGIEALFLIIENKQKNCDGQIINIGNPENEASIKQLAEQLLESFERHPLRDRFPPFAGFREVESSTYYGKGYQDVEHRKPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_YERPY (Bifunctional polymyxin resistance protein arnA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=arnA PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.344e-33
Identity = 77/183 (42.08%), Postives = 108/183 (59.02%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAKVSGEAALEEPTV----DVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A G + GL+FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KLVDGG  +R F  I D IEA+  +IEN     +G I N+GNP NE ++R+LAEM+   +   + E     P      D+ S  +YG+GY D + R P +
Sbjct:  446 EDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLD---NLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDIHDGIEALFRIIENRDGCCDGQIINIGNPTNEASIRELAEMLLTSFE--NHELRDHFPPFAGFKDIESSAYYGKGYQDVEYRTPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_YERPS (Bifunctional polymyxin resistance protein arnA OS=Yersinia pseudotuberculosis GN=arnA PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.344e-33
Identity = 77/183 (42.08%), Postives = 108/183 (59.02%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAKVSGEAALEEPTV----DVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A G + GL+FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KLVDGG  +R F  I D IEA+  +IEN     +G I N+GNP NE ++R+LAEM+   +   + E     P      D+ S  +YG+GY D + R P +
Sbjct:  446 EDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLD---NLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDIHDGIEALFRIIENRDGCCDGQIINIGNPTNEASIRELAEMLLTSFE--NHELRDHFPPFAGFKDIESSAYYGKGYQDVEYRTPSI 623          
BLAST of CX288532 vs. ExPASy Swiss-Prot
Match: ARNA_YERPP (Bifunctional polymyxin resistance protein arnA OS=Yersinia pestis (strain Pestoides F) GN=arnA PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.344e-33
Identity = 77/183 (42.08%), Postives = 108/183 (59.02%), Query Frame = 2
Query:   41 EDASPCIFGSIEKQRWSYACAKQLIERLIYAEGAENGLEFTIVRPFNWIGPRMDFIPGIDGPSEGVPRVLACFSNNLLRRQPLKLVDGGQSQRTFIYIKDAIEAVLLMIEN-PARANGHIFNVGNPHNEVTVRQLAEMMTEVYAKVSGEAALEEPTV----DVSSKEFYGEGYDDSDKRIPDM 574
            ED S  I G I KQRW Y+ +KQL++R+I+A G + GL+FT+ RPFNW+GPR+D    +D    G  R +     NL+   P+KLVDGG  +R F  I D IEA+  +IEN     +G I N+GNP NE ++R+LAEM+   +   + E     P      D+ S  +YG+GY D + R P +
Sbjct:  446 EDTSRLIVGPINKQRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLD---NLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQKRCFTDIHDGIEALFRIIENRDGCCDGRIINIGNPTNEASIRELAEMLLTSFE--NHELRDHFPPFAGFKDIESSAYYGKGYQDVEYRTPSI 623          
The following BLAST results are available for this feature:
BLAST of CX288532 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 75
Match NameE-valueIdentityDescription
ARNA_ERWCT6.062e-3543.09Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_YERE82.303e-3442.62Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_PROMH2.303e-3441.99Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_PECCP3.929e-3441.99Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_SERP58.753e-3442.54Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_KLEP72.547e-3339.78Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_ERWT93.326e-3340.33Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_YERPY4.344e-3342.08Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_YERPS4.344e-3342.08Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_YERPP4.344e-3342.08Bifunctional polymyxin resistance protein arnA OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC02001E03SK IF1 Citrus clementina cDNA clone C02001E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288532 ID=CX288532|Name=CX288532|organism=Citrus clementina|type=EST|length=592bp
TAGTCCTCTTCGGCAGGATCCTGCTTACTATGTTCTTAAAGAAGATGCCT
CCCCCTGCATTTTTGGCTCTATTGAGAAGCAGAGGTGGTCGTATGCATGT
GCAAAGCAATTGATTGAAAGGCTGATTTATGCTGAGGGTGCAGAGAATGG
TCTTGAGTTCACCATTGTGAGGCCCTTTAACTGGATTGGTCCGAGGATGG
ACTTCATTCCCGGCATTGATGGTCCAAGTGAGGGTGTTCCAAGGGTTCTG
GCATGCTTTAGTAACAATCTCCTTCGCCGGCAGCCACTCAAGCTTGTCGA
CGGTGGCCAATCTCAGAGGACTTTTATTTACATAAAGGATGCTATTGAAG
CTGTTCTATTAATGATTGAAAATCCAGCAAGGGCCAATGGTCATATTTTC
AATGTGGGCAACCCCCACAATGAAGTTACAGTTCGACAGCTTGCTGAGAT
GATGACTGAGGTGTATGCAAAGGTGAGTGGAGAGGCTGCTTTGGAGGAGC
CAACAGTTGATGTCAGCTCCAAAGAATTTTATGGTGAAGGATATGATGAT
AGTGACAAGAGAATTCCAGACATGACCATTATAAATCAACAG
back to top