CX289146
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289146 vs. ExPASy Swiss-Prot
Match: FTSH_PORPU (Cell division protease ftsH homolog OS=Porphyra purpurea GN=ftsH PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.260e-11 Identity = 36/64 (56.25%), Postives = 44/64 (68.75%), Query Frame = 1 Query: 7 PPGGGKTLLAKAVVG---ANFFSIPASQFVEIYVGFGASRVRSLYQEAKDNVNVISCFFSIEMV 189 PPG GKTLLAKA+ G FFSI S+FVE++VG GASRVR L+++AKDN I I+ V Sbjct: 214 PPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVFIDEIDAV 277
BLAST of CX289146 vs. ExPASy Swiss-Prot
Match: FSTH_PORYE (Cell division protease ftsH homolog OS=Porphyra yezoensis GN=ftsH PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.260e-11 Identity = 36/64 (56.25%), Postives = 44/64 (68.75%), Query Frame = 1 Query: 7 PPGGGKTLLAKAVVG---ANFFSIPASQFVEIYVGFGASRVRSLYQEAKDNVNVISCFFSIEMV 189 PPG GKTLLAKA+ G FFSI S+FVE++VG GASRVR L+++AKDN I I+ V Sbjct: 214 PPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVFIDEIDAV 277 The following BLAST results are available for this feature:
BLAST of CX289146 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289146 ID=CX289146; Name=CX289146; organism=Citrus clementina; type=EST; length=565bpback to top |