CX290864
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX290864 vs. ExPASy Swiss-Prot
Match: Y1719_ARATH (Probable inactive receptor kinase At1g27190 OS=Arabidopsis thaliana GN=At1g27190 PE=1 SV=1) HSP 1 Score: 107.071 bits (266), Expect = 2.958e-23 Identity = 48/84 (57.14%), Postives = 64/84 (76.19%), Query Frame = 1 Query: 1 WWWYHLRWVRRRKRGYGIGRDDDDSRWLERLRSHKLAQVSLVQKPLVKVKLADLMAASNSFCSENVIIPTRTGTTYKAMLSDGS 252 +WW+ +R R+K+GYG G+ DDS W+ LRSHKL QV+L QKP+VK+KL DLMAA+N+F S N+ + +RTG +YKA L DGS Sbjct: 241 FWWFFIREGSRKKKGYGAGKSKDDSDWIGLLRSHKLVQVTLFQKPIVKIKLGDLMAATNNFSSGNIDVSSRTGVSYKADLPDGS 324
BLAST of CX290864 vs. ExPASy Swiss-Prot
Match: Y1699_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g69990 OS=Arabidopsis thaliana GN=At1g69990 PE=2 SV=1) HSP 1 Score: 94.3597 bits (233), Expect = 1.984e-19 Identity = 44/85 (51.76%), Postives = 61/85 (71.76%), Query Frame = 1 Query: 1 WWWYHLRWVRRRKR-GYGIGRDDDDSRWLERLRSHKLAQVSLVQKPLVKVKLADLMAASNSFCSENVIIPTRTGTTYKAMLSDGS 252 +WW+ +R R+ GYG G+ DDS W+ LRSHKL QV+L QKP+VK+KL DL+ A+N F S N+++ +R+G +YKA L DGS Sbjct: 234 FWWFFIRDRRKMNNYGYGAGKCKDDSDWIGLLRSHKLVQVTLFQKPIVKIKLVDLIEATNGFDSGNIVVSSRSGVSYKADLPDGS 318 The following BLAST results are available for this feature:
BLAST of CX290864 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX290864 ID=CX290864; Name=CX290864; organism=Citrus clementina; type=EST; length=266bpback to top |