CX293885
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_GEOMG ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fabZ PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.784e-11 Identity = 31/46 (67.39%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 307 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444 TV DIN+I ILPHR+PFLLVDR++E+ PG V IKNVTIN+ FF Sbjct: 3 TVFDINEIMKILPHRYPFLLVDRIVEHVPGERIVGIKNVTINEPFF 48
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_SYNJA ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. (strain JA-3-3Ab) GN=fabZ PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.974e-11 Identity = 30/47 (63.83%), Postives = 36/47 (76.60%), Query Frame = 1 Query: 304 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444 P V +QI +ILPHR+PFLLVDRV+EY PG AV +KNVT N+ FF Sbjct: 23 PPVFTTDQILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFF 69
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_SYNJB ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. GN=fabZ PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 5.190e-11 Identity = 30/47 (63.83%), Postives = 35/47 (74.47%), Query Frame = 1 Query: 304 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444 P V QI +ILPHR+PFLLVDRV+EY PG AV +KNVT N+ FF Sbjct: 23 PPVFTTEQILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFF 69
BLAST of CX293885 vs. ExPASy Swiss-Prot
Match: FABZ_GEOUR ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Geobacter uraniireducens (strain Rf4) GN=fabZ PE=3 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 5.190e-11 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 313 MDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFF 444 MDIN+I ILPHRFPFL+VDR++E PG V +KNVTIN+ FF Sbjct: 1 MDINEIMKILPHRFPFLMVDRIVEMEPGKRCVGLKNVTINEPFF 44 The following BLAST results are available for this feature:
BLAST of CX293885 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX293885 ID=CX293885; Name=CX293885; organism=Citrus clementina; type=EST; length=445bpback to top |