CX294795

Overview
NameCX294795
Unique NameCX294795
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length653
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294795 vs. ExPASy Swiss-Prot
Match: RN160_MOUSE (RING finger protein 160 OS=Mus musculus GN=Rnf160 PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 3.416e-40
Identity = 68/135 (50.37%), Postives = 103/135 (76.30%), Query Frame = 3
Query:   69 SANEVVATYTKDETKMDLIIRLPASYPLRPVDVECMRSLGISEVKQRKWLMSMMLFVRNQNGALAEAIRIWKRNFDKEFEGVEECPICYSVIHTANHSLPRLACKTCKHKFHSACLYKWFSTSHKSSCPLCQSPF 473
            +  EV+ATYT ++  ++LII+LP++YPL  + VE  + +G++  + R W++ +  ++ +QNG++ E + +WK N DK FEGVE+C IC+SVIH  N+SLP+ AC+TCK KFHSACLYKWF++S+KS+CPLC+  F
Sbjct: 1632 TTREVMATYTIEDIVIELIIQLPSNYPLGSITVESGKRIGVAVQQWRNWMLQLSTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETF 1766          
BLAST of CX294795 vs. ExPASy Swiss-Prot
Match: RN160_HUMAN (RING finger protein 160 OS=Homo sapiens GN=RNF160 PE=1 SV=5)

HSP 1 Score: 163.696 bits (413), Expect = 7.609e-40
Identity = 68/135 (50.37%), Postives = 103/135 (76.30%), Query Frame = 3
Query:   69 SANEVVATYTKDETKMDLIIRLPASYPLRPVDVECMRSLGISEVKQRKWLMSMMLFVRNQNGALAEAIRIWKRNFDKEFEGVEECPICYSVIHTANHSLPRLACKTCKHKFHSACLYKWFSTSHKSSCPLCQSPF 473
            +  EV+ATYT ++  ++LII+LP++YPL  + VE  + +G++  + R W++ +  ++ +QNG++ E + +WK N DK FEGVE+C IC+SVIH  N+SLP+ AC+TCK KFHSACLYKWF++S+KS+CPLC+  F
Sbjct: 1631 TTREVMATYTIEDIVIELIIQLPSNYPLGSIIVESGKRVGVAVQQWRNWMLQLSTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETF 1765          
BLAST of CX294795 vs. ExPASy Swiss-Prot
Match: YO89_SCHPO (Uncharacterized RING finger protein C21D10.09c OS=Schizosaccharomyces pombe GN=SPBC21D10.09c PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.096e-33
Identity = 59/141 (41.84%), Postives = 97/141 (68.79%), Query Frame = 3
Query:   51 SLTVSKSANEVVATYTKDETKMDLIIRLPASYPLRPVDVECMRSLGISEVKQRKWLMSMMLFVRNQNGALAEAIRIWKRNFDKEFEGVEECPICYSVIHTANHSLPRLACKTCKHKFHSACLYKWFSTSHKSSCPLCQSPF 473
            ++ V+++  E+   Y  DE K+++ I++P+ YPL+ V VE +  +G++E + R W+++    + +QNG++ +A+ + K+N    FEGVEEC ICYSV+ +   +LP   C TC+HKFH++CLYKWF +S+ S CPLC+S F
Sbjct: 1468 NVKVNRNTREISFIYNVDEHKLEMAIKIPSVYPLQNVQVEGIERVGVNERQWRSWILASQSILSSQNGSITDALLVLKKNISMHFEGVEECAICYSVL-SVERTLPNKRCGTCRHKFHASCLYKWFKSSNSSRCPLCRSSF 1607          
BLAST of CX294795 vs. ExPASy Swiss-Prot
Match: YM81_YEAST (RING finger protein YMR247C OS=Saccharomyces cerevisiae GN=YMR247C PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.177e-32
Identity = 57/143 (39.86%), Postives = 93/143 (65.03%), Query Frame = 3
Query:   39 DENFSLTVSKSANEVVATYTKDETKMDLIIRLPASYPLRPVDVECMRSLGISEVKQRKWLMSMMLFVRNQNGALAEAIRIWKRNFDKEFEGVEECPICYSVIHTANHSLPRLACKTCKHKFHSACLYKWFSTSHKSSCPLCQS 467
            D+  ++ ++   NEV A+Y  D+ K+++  +LP +YPL  + V  +  +GISE K ++W+MS    +   NG++ +++ ++ +N   +F G EEC ICYS++H  +  LP   C TCK+KFH ACLYKWF +S  ++CPLC+S
Sbjct: 1414 DDALTIKLNNITNEVKASYLIDDQKLEISFKLPKNYPLTNIQVNGVSRVGISEQKWKQWIMSTQHVITGMNGSVLDSLELFTKNVHLQFSGFEECAICYSILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCRS 1556          
The following BLAST results are available for this feature:
BLAST of CX294795 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
RN160_MOUSE3.416e-4050.37RING finger protein 160 OS=Mus musculus GN=Rnf160 ... [more]
RN160_HUMAN7.609e-4050.37RING finger protein 160 OS=Homo sapiens GN=RNF160 ... [more]
YO89_SCHPO3.096e-3341.84Uncharacterized RING finger protein C21D10.09c OS=... [more]
YM81_YEAST1.177e-3239.86RING finger protein YMR247C OS=Saccharomyces cerev... [more]
back to top
Libraries
Library NameType
PhIFruit1cdna_library
Properties
Property NameValue
Genbank descriptionC05056A08SK PhIFruit1 Citrus clementina cDNA clone C05056A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294795 ID=CX294795|Name=CX294795|organism=Citrus clementina|type=EST|length=653bp
ATTCCATTCTATTGCAGATAAAGAAGGCCAATATTGCTGATGAGAATTTT
TCACTTACCGTAAGCAAATCAGCAAATGAGGTTGTTGCCACATACACAAA
GGATGAGACGAAAATGGATCTTATTATCCGTCTTCCTGCATCCTACCCAT
TACGTCCTGTTGATGTTGAATGTATGAGGAGCCTAGGGATTAGTGAAGTG
AAGCAGAGGAAGTGGTTGATGTCAATGATGTTGTTTGTTCGTAATCAGAA
TGGAGCTTTAGCTGAAGCAATACGGATATGGAAGCGCAACTTTGACAAGG
AATTCGAAGGTGTTGAGGAGTGCCCAATTTGTTACAGTGTCATCCACACT
GCCAACCATAGCCTTCCTCGTCTTGCTTGCAAGACGTGCAAACACAAGTT
CCATTCAGCCTGCCTCTACAAGTGGTTCTCAACTTCTCACAAATCATCAT
GCCCATTGTGCCAATCTCCATTCTGACCTAGACATCAATTGTAGTTATTC
GTGGATTTTGCTCCTCTGGTTGCAACCGACATCAACGTAAAAAGAAGTGA
CTACTGTAGAACAGAAGGATAGATTACAATGTTACATATGTCTCAAGTTT
AAATACTATTACTAGTGTGAAAGTCACAGATGCTGATTCGAGCTGGAACC
ACT
back to top