CX295199
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX295199 vs. ExPASy Swiss-Prot
Match: ZN363_HUMAN (RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 3.540e-17 Identity = 41/85 (48.24%), Postives = 51/85 (60.00%), Query Frame = -3 Query: 437 QKLLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 691 +++LKE Y CP+C S DM++ W + D E+A TPMP Y N V ILCNDC S VQFH+L KC C+SYNT G Sbjct: 174 EEMLKE-----GYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGG 253
BLAST of CX295199 vs. ExPASy Swiss-Prot
Match: ZN363_MOUSE (RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 6.039e-17 Identity = 41/85 (48.24%), Postives = 50/85 (58.82%), Query Frame = -3 Query: 437 QKLLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 691 +++LKE Y CP+C S DM++ W + D E+A TPMP Y N V ILCNDC S VQFH+L KC C SYNT G Sbjct: 174 EEMLKE-----GYRCPLCMHSALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGG 253 The following BLAST results are available for this feature:
BLAST of CX295199 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX295199 ID=CX295199; Name=CX295199; organism=Citrus clementina; type=EST; length=702bpback to top |