CX296275

Overview
NameCX296275
Unique NameCX296275
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length576
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP337_ARATH (Pentatricopeptide repeat-containing protein At4g25270, chloroplastic OS=Arabidopsis thaliana GN=PCMP-E53 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 5.241e-57
Identity = 105/170 (61.76%), Postives = 138/170 (81.18%), Query Frame = 2
Query:   68 TFSSYPKSSPTPLLTNQKAFPKTKLQALDSIIQDLESSVQNGITV-QTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            T  S+ K SPTPLL  +++  +T+L+ALDS+I DLE+S Q GI++ + E FASLLETCY L+A++HG+++H LIP  LLR N GISSKL+RLYA+ G  + AH+VFD+MS R +  F WNSLISGYAELG+YEDA+ALYFQM E+GV+PD+FTFPRVLKAC G+G +++G
Sbjct:   45 TSLSFTKPSPTPLLIEKQSIHRTQLEALDSVITDLETSAQKGISLTEPEIFASLLETCYSLRAIDHGVRVHHLIPPYLLRNNLGISSKLVRLYASCGYAEVAHEVFDRMSKRDSSPFAWNSLISGYAELGQYEDAMALYFQMAEDGVKPDRFTFPRVLKACGGIGSVQIG 214          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP296_ARATH (Pentatricopeptide repeat-containing protein At3g63370 OS=Arabidopsis thaliana GN=PCMP-H83 PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.262e-18
Identity = 61/154 (39.61%), Postives = 85/154 (55.19%), Query Frame = 2
Query:  128 PKTKLQALDSII----QDLESSVQNGITVQTETFASLLETCYQLKAVEHGIKLH-RLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            P  KL   D ++    Q L+ S  N      E FA +LE C + +AV  G +LH R+  T    +   ++ KL+ +Y   G +D+A +VFD+M +RTAFA  WN++I  Y   GE   A+ALY+ M  EGV     +FP +LKACA L  IR G
Sbjct:   53 PSPKLACFDGVLTEAFQRLDVSENNS---PVEAFAYVLELCGKRRAVSQGRQLHSRIFKTFPSFELDFLAGKLVFMYGKCGSLDDAEKVFDEMPDRTAFA--WNTMIGAYVSNGEPASALALYWNMRVEGVPLGLSSFPALLKACAKLRDIRSG 201          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PPR8_ARATH (Pentatricopeptide repeat-containing protein At1g03540 OS=Arabidopsis thaliana GN=PCMP-E4 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.822e-17
Identity = 47/128 (36.72%), Postives = 76/128 (59.38%), Query Frame = 2
Query:  191 GITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            G+     TF ++L  C  L+ ++ G ++H  + TN +  N  + S LL +Y   G + EA QVF+ MS + + +  W++L+ GY + GE+E AI ++ +MEE+    D + F  VLKACAGL  +R+G
Sbjct:  260 GLVPDGSTFGTVLTACGNLRRLKQGKEIHGKLITNGIGSNVVVESSLLDMYGKCGSVREARQVFNGMSKKNSVS--WSALLGGYCQNGEHEKAIEIFREMEEK----DLYCFGTVLKACAGLAAVRLG 381          

HSP 2 Score: 77.7962 bits (190), Expect = 4.201e-14
Identity = 50/167 (29.94%), Postives = 87/167 (52.10%), Query Frame = 2
Query:   77 SYPKSSPTPLLTNQKAFPKTKLQALDSIIQDLESSVQNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGL-IDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            S   S+PT      +     KL  L   I+ L S+  + I    + +ASLL+TC ++ +  HGI+ H  +  + L  ++ + + LL LY   G  + E  +VFD    + A +  W S++SGY    E+  A+ ++ +M   G++ ++FT    +KAC+ LG +R+G
Sbjct:   21 SISSSAPTK---QSRILELCKLGQLTEAIRILNSTHSSEIPATPKLYASLLQTCNKVFSFIHGIQFHAHVVKSGLETDRNVGNSLLSLYFKLGPGMRETRRVFDGRFVKDAIS--WTSMMSGYVTGKEHVKALEVFVEMVSFGLDANEFTLSSAVKACSELGEVRLG 182          

HSP 3 Score: 69.707 bits (169), Expect = 1.144e-11
Identity = 38/120 (31.67%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  215 FASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            F ++L+ C  L AV  G ++H          N  + S L+ LY   G ID A +V+ +MS R      WN+++S  A+ G  E+A++ +  M ++G++PD  +F  +L AC   G++  G
Sbjct:  365 FGTVLKACAGLAAVRLGKEIHGQYVRRGCFGNVIVESALIDLYGKSGCIDSASRVYSKMSIRNMIT--WNAMLSALAQNGRGEEAVSFFNDMVKKGIKPDYISFIAILTACGHTGMVDEG 482          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP115_ARATH (Pentatricopeptide repeat-containing protein At1g71460, chloroplastic OS=Arabidopsis thaliana GN=PCMP-A3 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 9.044e-17
Identity = 50/169 (29.59%), Postives = 91/169 (53.85%), Query Frame = 2
Query:   74 SSYPKSSPTPLLTNQKAFPKTKLQALDSIIQDLESSVQNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGE--YEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            SS P  S  P + ++      +   L+  +  L+   Q GI V   TF++LLE C + K++ HG ++H  I  N L  N+ + +KL+ +Y   G + +A +VFD+ ++   ++  WN+L+ G    G+  Y+D ++ + +M E GV+ + ++   V K+ AG   +R G
Sbjct:   67 SSLPLHSKNPYIIHRDIQIFARQNNLEVALTILDYLEQRGIPVNATTFSALLEACVRRKSLLHGKQVHVHIRINGLESNEFLRTKLVHMYTACGSVKDAQKVFDESTSSNVYS--WNALLRGTVISGKKRYQDVLSTFTEMRELGVDLNVYSLSNVFKSFAGASALRQG 233          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP315_ARATH (Pentatricopeptide repeat-containing protein At4g16470 OS=Arabidopsis thaliana GN=PCMP-E12 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 7.656e-16
Identity = 46/130 (35.38%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  185 QNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            QN I     TFAS+   C  L  +EHG + H ++    ++ N  + S L+ +Y       + H+VFDQ+S R      W SLISGY   G+  + +  + +M+EEG  P+  TF  VL AC   GL+  G
Sbjct:  202 QNRIVPDQYTFASVFRACSALDRLEHGKRAHAVMIKRCIKSNIIVDSALVDMYFKCSSFSDGHRVFDQLSTRNVIT--WTSLISGYGYHGKVSEVLKCFEKMKEEGCRPNPVTFLVVLTACNHGGLVDKG 329          

HSP 2 Score: 80.1073 bits (196), Expect = 8.465e-15
Identity = 43/129 (33.33%), Postives = 70/129 (54.26%), Query Frame = 2
Query:  188 NGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            +G+ V+ ET+A LL+ C Q K    G ++H  +       N+ +  KLL LYA  G +  A  +F  +  R     PWN++ISGY + G  ++ + +Y+ M +  + PDQ+TF  V +AC+ L  +  G
Sbjct:  102 SGLQVEPETYAVLLQECKQRKEYTKGKRIHAQMFVVGFALNEYLKVKLLILYALSGDLQTAGILFRSLKIRDLI--PWNAMISGYVQKGLEQEGLFIYYDMRQNRIVPDQYTFASVFRACSALDRLEHG 228          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP151_ARATH (Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.000e-15
Identity = 44/130 (33.85%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  185 QNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            + G  +   +FAS+L  C  L  +  G+++H LI  +    +  I S L+ +Y+  G +++A +VFD+M +R   +  WNSLI+ + + G   +A+ ++  M E  VEPD+ T   V+ ACA L  I+VG
Sbjct:  145 KEGFVLNEYSFASVLSACSGLNDMNKGVQVHSLIAKSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVS--WNSLITCFEQNGPAVEALDVFQMMLESRVEPDEVTLASVISACASLSAIKVG 272          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP330_ARATH (Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.306e-15
Identity = 45/134 (33.58%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  173 ESSVQNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            E  V   +   T T+  L++    +  V  G  +H ++  +       + + LL LYA  G +  A++VFD+M  +   A  WNS+I+G+AE G+ E+A+ALY +M  +G++PD FT   +L ACA +G + +G
Sbjct:  110 EMRVSGLVEPDTHTYPFLIKAVTTMADVRLGETIHSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVA--WNSVINGFAENGKPEEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLG 241          

HSP 2 Score: 70.0922 bits (170), Expect = 8.760e-12
Identity = 46/129 (35.66%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  191 GITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEE-EGVEPDQFTFPRVLKACAGLGLIRVG 574
            GI     T  SLL  C ++ A+  G ++H  +    L +N   S+ LL LYA  G ++EA  +FD+M ++ + +  W SLI G A  G  ++AI L+  ME  EG+ P + TF  +L AC+  G+++ G
Sbjct:  217 GIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYARCGRVEEAKTLFDEMVDKNSVS--WTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFVGILYACSHCGMVKEG 343          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PP182_ARATH (Pentatricopeptide repeat-containing protein At2g33760 OS=Arabidopsis thaliana GN=PCMP-H6 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.909e-15
Identity = 47/160 (29.38%), Postives = 82/160 (51.25%), Query Frame = 2
Query:   95 PTPLLTNQKAFPKTKLQALDSIIQDLESSVQNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            P   L N      +KL+     +      + + ++    TF S++++C  L A+  G  +H     +    +  + + L+  Y+  G ++ A QVFD+M  ++  A  WNSL+SG+ + G  ++AI +++QM E G EPD  TF  +L ACA  G + +G
Sbjct:   70 PDDFLFNSVIKSTSKLRLPLHCVAYYRRMLSSNVSPSNYTFTSVIKSCADLSALRIGKGVHCHAVVSGFGLDTYVQAALVTFYSKCGDMEGARQVFDRMPEKSIVA--WNSLVSGFEQNGLADEAIQVFYQMRESGFEPDSATFVSLLSACAQTGAVSLG 227          

HSP 2 Score: 78.5666 bits (192), Expect = 2.463e-14
Identity = 49/142 (34.51%), Postives = 73/142 (51.41%), Query Frame = 2
Query:  152 DSIIQDLESSVQNGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEE-GVEPDQFTFPRVLKACAGLGLIRVG 574
            D  IQ      ++G    + TF SLL  C Q  AV  G  +H+ I +  L  N  + + L+ LY+  G + +A +VFD+M      A  W ++IS Y   G  + A+ L+ +ME++ G  P+  TF  VL ACA  GL+  G
Sbjct:  190 DEAIQVFYQMRESGFEPDSATFVSLLSACAQTGAVSLGSWVHQYIISEGLDLNVKLGTALINLYSRCGDVGKAREVFDKMKETNVAA--WTAMISAYGTHGYGQQAVELFNKMEDDCGPIPNNVTFVAVLSACAHAGLVEEG 329          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PPR62_ARATH (Pentatricopeptide repeat-containing protein At1g28690, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E34 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 4.963e-15
Identity = 49/137 (35.77%), Postives = 77/137 (56.20%), Query Frame = 2
Query:  167 DLESSVQN-GITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            D+  S+Q  G      TFAS++  C  L + E G ++H  I  + +  +  + S LL +YA  G I++A +VFDQM  +  F+  W S+I GY + G  E+A+ L+ +M+E  +EP+  TF   L AC+  GL+  G
Sbjct:  259 DMYISMQRAGFHPNISTFASVIGACSVLTSHEVGQQVHAQIMKSGVYTHIKMGSSLLDMYAKCGGINDARRVFDQMQEKNVFS--WTSMIDGYGKNGNPEEALELFTRMKEFRIEPNYVTFLGALSACSHSGLVDKG 393          
BLAST of CX296275 vs. ExPASy Swiss-Prot
Match: PPR13_ARATH (Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana GN=PDE247 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.465e-15
Identity = 41/129 (31.78%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  188 NGITVQTETFASLLETCYQLKAVEHGIKLHRLIPTNLLRKNKGISSKLLRLYATFGLIDEAHQVFDQMSNRTAFAFPWNSLISGYAELGEYEDAIALYFQMEEEGVEPDQFTFPRVLKACAGLGLIRVG 574
            +G+        + L  C  L A+  G+ +HR + +   + N  +S+ L+ LY   G ++ A QVF  M  RT  +  WNS+I G+A  G   +++  + +M+E+G +PD  TF   L AC+ +GL+  G
Sbjct:  200 SGVKPDYVAIIAALNACTNLGALSFGLWVHRYVLSQDFKNNVRVSNSLIDLYCRCGCVEFARQVFYNMEKRTVVS--WNSVIVGFAANGNAHESLVYFRKMQEKGFKPDAVTFTGALTACSHVGLVEEG 326          
The following BLAST results are available for this feature:
BLAST of CX296275 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 116
Match NameE-valueIdentityDescription
PP337_ARATH5.241e-5761.76Pentatricopeptide repeat-containing protein At4g25... [more]
PP296_ARATH1.262e-1839.61Pentatricopeptide repeat-containing protein At3g63... [more]
PPR8_ARATH1.822e-1736.72Pentatricopeptide repeat-containing protein At1g03... [more]
PP115_ARATH9.044e-1729.59Pentatricopeptide repeat-containing protein At1g71... [more]
PP315_ARATH7.656e-1635.38Pentatricopeptide repeat-containing protein At4g16... [more]
PP151_ARATH1.000e-1533.85Pentatricopeptide repeat-containing protein At2g13... [more]
PP330_ARATH1.306e-1533.58Pentatricopeptide repeat-containing protein At4g21... [more]
PP182_ARATH2.909e-1529.38Pentatricopeptide repeat-containing protein At2g33... [more]
PPR62_ARATH4.963e-1535.77Pentatricopeptide repeat-containing protein At1g28... [more]
PPR13_ARATH8.465e-1531.78Pentatricopeptide repeat-containing protein At1g05... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05138C02SK FerrChloL1 Citrus clementina cDNA clone C05138C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296275 ID=CX296275|Name=CX296275|organism=Citrus clementina|type=EST|length=576bp
CAAAAACAAGAGAAGTAGGAAACAGAGACGACAAAAACAACAACAAATTT
CTCGAAACAGAATCACCACTTTCTCCTCTTATCCAAAATCATCCCCAACC
CCACTTCTAACTAATCAAAAAGCTTTCCCCAAAACTAAACTCCAAGCCTT
AGACTCCATCATTCAAGACCTCGAATCCTCTGTTCAAAACGGCATCACTG
TGCAAACTGAAACCTTCGCTTCTCTTCTTGAGACGTGTTACCAATTAAAA
GCCGTAGAACATGGAATTAAGCTTCATCGTTTGATACCCACAAATCTTTT
ACGCAAAAATAAGGGCATTTCGTCAAAATTGCTGAGGTTATACGCAACGT
TTGGCCTTATCGATGAAGCGCACCAAGTTTTTGATCAAATGTCTAATAGA
ACAGCGTTTGCGTTTCCTTGGAATTCGCTTATATCAGGATATGCTGAATT
GGGTGAGTATGAAGACGCCATAGCGCTTTACTTCCAAATGGAGGAAGAAG
GCGTTGAACCGGACCAGTTCACATTCCCTCGAGTGTTGAAAGCTTGTGCT
GGACTTGGGTTAATTCGGGTTGGTGA
back to top