CX296733

Overview
NameCX296733
Unique NameCX296733
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length405
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 2.385e-26
Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = -1
Query:  133 GKAAQQMNVPVPEGCTDPTAENFDPTSRSDDGSCQYS 243
            GK AQQ+N+PVPEGCTDP AENFDPT+RSDDG+C Y+
Sbjct:  437 GKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYN 473          

HSP 2 Score: 67.3958 bits (163), Expect = 2.385e-26
Identity = 32/41 (78.05%), Postives = 36/41 (87.80%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            GNM+V EQENVKRVQLA+ YLS+AALG+ANADAI  G FYG
Sbjct:  397 GNMLVMEQENVKRVQLAETYLSQAALGDANADAIGRGTFYG 437          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 6.845e-26
Identity = 33/41 (80.49%), Postives = 37/41 (90.24%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            G M+VQEQENVKRVQLADKY+SEAALG+AN DAI+ G FYG
Sbjct:  397 GGMLVQEQENVKRVQLADKYMSEAALGDANNDAIKRGTFYG 437          

HSP 2 Score: 66.6254 bits (161), Expect = 6.845e-26
Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = -1
Query:  136 GGKAAQQM-NVPVPEGCTDPTAENFDPTSRSDDGSCQY 246
            GG+AAQQ+ NVPVPEGCTDP A N+DPT+RSDDGSC Y
Sbjct:  437 GGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVY 474          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA_SPIOL (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 5.637e-25
Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            GNM+VQEQENVKRVQLAD+Y+S AALG+AN DAI  G F+G
Sbjct:  395 GNMLVQEQENVKRVQLADQYMSSAALGDANKDAIDRGTFFG 435          

HSP 2 Score: 66.2402 bits (160), Expect = 5.637e-25
Identity = 27/38 (71.05%), Postives = 35/38 (92.11%), Query Frame = -1
Query:  130 GKAAQQMNVPVPEGCTDPTAENFDPTSRSDDGSCQYSL 243
            GKAAQQ+++PV +GCTDP A+N+DPT+RSDDGSC Y+L
Sbjct:  435 GKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTYNL 472          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 6.036e-24
Identity = 30/41 (73.17%), Postives = 40/41 (97.56%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            G M+V+EQENVKRVQLA++YLSEAALG+AN+DA+++G+FYG
Sbjct:  388 GYMLVKEQENVKRVQLAEQYLSEAALGDANSDAMKTGSFYG 428          

HSP 2 Score: 63.5438 bits (153), Expect = 6.036e-24
Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = -1
Query:  133 GKAAQQM-NVPVPEGCTDPTAENFDPTSRSDDGSCQYS 243
            G+ AQQ  N+PVPEGCTDP A+NFDPT+RSDDGSC Y+
Sbjct:  428 GQGAQQAGNLPVPEGCTDPVAKNFDPTARSDDGSCLYT 465          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.731e-23
Identity = 29/41 (70.73%), Postives = 39/41 (95.12%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            G+M+VQEQ+NVKRVQLAD Y+S+AALG+AN DA+++G+FYG
Sbjct:  387 GHMLVQEQDNVKRVQLADTYMSQAALGDANQDAMKTGSFYG 427          

HSP 2 Score: 62.3882 bits (150), Expect = 1.731e-23
Identity = 26/37 (70.27%), Postives = 31/37 (83.78%), Query Frame = -1
Query:  133 GKAAQQMNVPVPEGCTDPTAENFDPTSRSDDGSCQYS 243
            GK AQQ  +PVPEGCTD  A+N+DPT+RSDDGSC Y+
Sbjct:  427 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYT 463          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.639e-13
Identity = 34/41 (82.93%), Postives = 39/41 (95.12%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            GNM+VQEQENVKRVQLADKYLSEAALG+AN+DA+ +G FYG
Sbjct:  397 GNMLVQEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.359e-12
Identity = 33/40 (82.50%), Postives = 38/40 (95.00%), Query Frame = -3
Query:  284 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFY 403
            GNM+VQEQENVKRVQLADKYL EAALG+ANADAI +G+F+
Sbjct:  401 GNMLVQEQENVKRVQLADKYLKEAALGDANADAINNGSFF 440          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 4.023e-12
Identity = 33/40 (82.50%), Postives = 38/40 (95.00%), Query Frame = -3
Query:  284 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFY 403
            GNM+VQEQENVKRVQLADKYL+EAALG AN DAI+SG+F+
Sbjct:  399 GNMLVQEQENVKRVQLADKYLNEAALGNANEDAIKSGSFF 438          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.023e-12
Identity = 33/41 (80.49%), Postives = 39/41 (95.12%), Query Frame = -3
Query:  281 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFYG 403
            G+M+VQEQENVKRVQLADKYLSEAALG+AN DA+++G FYG
Sbjct:  384 GHMLVQEQENVKRVQLADKYLSEAALGQANDDAMKTGAFYG 424          
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.997e-11
Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = -3
Query:  287 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNF 403
            GNM+VQEQENVKRVQLA+ YL EAALG+ANADAI +GNF
Sbjct:  401 GNMLVQEQENVKRVQLAETYLKEAALGDANADAINTGNF 439          
The following BLAST results are available for this feature:
BLAST of CX296733 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
RCA_ARATH2.385e-2678.38Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_LARTR6.845e-2680.49Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SPIOL5.637e-2575.61Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ6.036e-2473.17Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU1.731e-2370.73Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO3.639e-1382.93Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC2.359e-1282.50Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU4.023e-1282.50Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU4.023e-1280.49Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC1.997e-1182.05Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802B11SK FerrChloL1 Citrus clementina cDNA clone C05802B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296733 ID=CX296733|Name=CX296733|organism=Citrus clementina|type=EST|length=405bp
AATTCGGCACGAGGCAAAATTAGATCCTTCTTTCTAATTAACAAAGAAAT
GAAAATGCAACAATATTATTTGAATATCTCACATCCTAAGCAAAGTGCGA
CACTTCTCAACCCTTAAAAACAAGGCCTAAAGCGAGTATTGGCAGCTTCC
ATCATCACTTCTTGAAGTTGGATCAAAGTTTTCTGCAGTAGGATCAGTAC
ATCCTTCAGGAACTGGAACATTCATTTGCTGGGCTGCTTTGCCTCCCATC
AAGGCCTCTTAGCTAGGATCAAGGGGGCTAACCATAGAAATTTCCACTCT
GAATAGCATCTGCATTAGCTTCACCAAGAGCGGCCTCACTCAAATACTTG
TCAGCCAACTGAACTCTCTTCACATTCTCTTGCTCTTGCACAATCATGTT
TCCGT
back to top