CX299943

Overview
NameCX299943
Unique NameCX299943
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length610
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig819 contig Ccv1_Contig819:1..610. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_FLAAN (Glycine cleavage system H protein, mitochondrial OS=Flaveria anomala GN=GDCSH PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.930e-71
Identity = 128/162 (79.01%), Postives = 147/162 (90.74%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 522
            MALRMWASSTANALR+S A++     LSRCFSSVLDGLKYA+SHEWVKHEGSVAT+GITDHAQDHLGEVVFV+LPE G SV +  GFG VESVKATSDVNSPISGE++EVN+KL+ETPGL+NSSPYE+GW+IKVKPS+PS+L+SLM  + YTKFCEEE+AAH
Sbjct:    1 MALRMWASSTANALRLSSATRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATIGITDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETPGLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEEEDAAH 162          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_FLAPR (Glycine cleavage system H protein, mitochondrial OS=Flaveria pringlei GN=GDCSH PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.251e-70
Identity = 126/162 (77.78%), Postives = 147/162 (90.74%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 522
            MALR+WASSTANALR+S A++     LSRCFSSVLDGLKYA+SHEWVKHEGSVAT+GITDHAQDHLGEVVFV+LPE G SV +  GFG VESVKATSDVNSPISGE++EVN+KL+ETPGL+NSSPYE+GW+IKVKPS+PS+L+SLM  + YTKFCEEE++AH
Sbjct:    1 MALRIWASSTANALRLSSATRPHFSPLSRCFSSVLDGLKYANSHEWVKHEGSVATIGITDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETPGLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYTKFCEEEDSAH 162          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_PEA (Glycine cleavage system H protein, mitochondrial OS=Pisum sativum GN=GDCSH PE=1 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.634e-70
Identity = 128/165 (77.58%), Postives = 147/165 (89.09%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASK---TPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 522
            MALRMWASSTANAL++S +S+   +P F++SRCFS+VLDGLKYA SHEWVKHEGSVAT+GITDHAQDHLGEVVFVELPE G SV +G GFG VESVKATSDVNSPISGEVIEVNT LT  PGL+NSSPYE+GW+IK+KP+SP +LESL+  + YTKFCEEE+AAH
Sbjct:    1 MALRMWASSTANALKLSSSSRLHLSPTFSISRCFSNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH 165          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH2_ARATH (Probable glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana GN=At1g32470 PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 3.640e-70
Identity = 130/166 (78.31%), Postives = 151/166 (90.96%), Query Frame = 1
Query:   37 MALRMWASSTANALRISC-ASKT---PAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 522
            MALRMWASSTANAL++S  ASK+   PAF++SRCFSSVL+GLKYA+SHEWVKHEGSVAT+GITDHAQDHLGEVVFVELPE  +SV +   FG VESVKATS++ SPISGEVIEVNTKLTE+PGL+NSSPYE+GW+IKVKPSSP++LE+LM P+ YTKFCEEE+AAH
Sbjct:    1 MALRMWASSTANALKLSSSASKSHLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEANSSVSKEKSFGAVESVKATSEILSPISGEVIEVNTKLTESPGLINSSPYEDGWMIKVKPSSPAELEALMGPKEYTKFCEEEDAAH 166          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_ORYSJ (Glycine cleavage system H protein, mitochondrial OS=Oryza sativa subsp. japonica GN=GDCSH PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 8.965e-69
Identity = 124/163 (76.07%), Postives = 146/163 (89.57%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKT---PAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENA 516
            MALR+WASS ANAL+ISC+  T   PA+++SR FS+VLDGLKY+SSHEWVK++GSVAT+GITDHAQ HLGEVVFVELPE GA V QGG FG VESVKATSD+NSPISGEV+EVN KL+ETPGL+NSSPYE+GW+IKVKPSSPS+L++L+DP  YTK CEEE+A
Sbjct:    1 MALRLWASSAANALKISCSGATRAAPAYSISRYFSTVLDGLKYSSSHEWVKNDGSVATIGITDHAQGHLGEVVFVELPEAGAKVSQGGAFGNVESVKATSDINSPISGEVVEVNDKLSETPGLINSSPYEDGWMIKVKPSSPSELDALLDPAKYTKHCEEEDA 163          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_ORYSI (Glycine cleavage system H protein, mitochondrial OS=Oryza sativa subsp. indica GN=GDCSH PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 8.965e-69
Identity = 124/163 (76.07%), Postives = 146/163 (89.57%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKT---PAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENA 516
            MALR+WASS ANAL+ISC+  T   PA+++SR FS+VLDGLKY+SSHEWVK++GSVAT+GITDHAQ HLGEVVFVELPE GA V QGG FG VESVKATSD+NSPISGEV+EVN KL+ETPGL+NSSPYE+GW+IKVKPSSPS+L++L+DP  YTK CEEE+A
Sbjct:    1 MALRLWASSAANALKISCSGATRAAPAYSISRYFSTVLDGLKYSSSHEWVKNDGSVATIGITDHAQGHLGEVVFVELPEAGAKVSQGGAFGNVESVKATSDINSPISGEVVEVNDKLSETPGLINSSPYEDGWMIKVKPSSPSELDALLDPAKYTKHCEEEDA 163          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_FLATR (Glycine cleavage system H protein, mitochondrial OS=Flaveria trinervia GN=GDCSH PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 3.407e-68
Identity = 126/163 (77.30%), Postives = 143/163 (87.73%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKTPAFALSRCFSS--VLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAA 519
            MALR+WASSTA ALR+S AS+     L RCFSS  VLDGLKYA+SHEWVKHEGSVAT+GITDHAQDHLGEVVFVELPE G SV +  GFG VESVKATSDVNSPISGE++EVN+KLT+TPGL+N SPYE+GW+IKVKPS+PS+L+SLM P+ YTKFCEEE AA
Sbjct:    1 MALRIWASSTAKALRLSSASRPHFSPLFRCFSSAAVLDGLKYANSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEVGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLTKTPGLINKSPYEDGWMIKVKPSNPSELDSLMGPKEYTKFCEEEGAA 163          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH1_ARATH (Glycine cleavage system H protein 1, mitochondrial OS=Arabidopsis thaliana GN=GDCSH PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.431e-66
Identity = 123/165 (74.55%), Postives = 143/165 (86.67%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCA---SKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENAAH 522
            MALRMWASSTANAL++S +   S    F+ SRCFS+VL+GLKYA+SHEWVKHEGSVAT+GIT HAQDHLGEVVFVELPE   SV +   FG VESVKATS++ SPISGE+IEVN KLTE+PGL+NSSPYE+GW+IKVKPSSP++LESLM P+ YTKFCEEE+AAH
Sbjct:    1 MALRMWASSTANALKLSSSVSKSHLSPFSFSRCFSTVLEGLKYANSHEWVKHEGSVATIGITAHAQDHLGEVVFVELPEDNTSVSKEKSFGAVESVKATSEILSPISGEIIEVNKKLTESPGLINSSPYEDGWMIKVKPSSPAELESLMGPKEYTKFCEEEDAAH 165          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_MESCR (Glycine cleavage system H protein, mitochondrial OS=Mesembryanthemum crystallinum GN=GDCSH PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.582e-65
Identity = 123/163 (75.46%), Postives = 142/163 (87.12%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKT---PAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYTKFCEEENA 516
            MALRMWASS ANAL +SCA K+   PA +LSRCFS+VLDGLKYASSHEWVKH GSVAT+GITDHAQ HLG+VVF ELPE GA V  G  F  VESVKATSDVNSPISGE++EVNTKL+++PGL+NSSPYEEGW++KVKPS+P++LESLM  + YTKFCEEE+A
Sbjct:    1 MALRMWASSAANALGVSCAPKSHLLPALSLSRCFSTVLDGLKYASSHEWVKHGGSVATIGITDHAQGHLGDVVFAELPEGGA-VSAGKPFASVESVKATSDVNSPISGEIVEVNTKLSDSPGLLNSSPYEEGWMVKVKPSNPAELESLMGSKEYTKFCEEEDA 162          
BLAST of CX299943 vs. ExPASy Swiss-Prot
Match: GCSH_FLAPU (Glycine cleavage system H protein, mitochondrial (Fragment) OS=Flaveria pubescens GN=GDCSH PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.582e-65
Identity = 120/152 (78.95%), Postives = 137/152 (90.13%), Query Frame = 1
Query:   37 MALRMWASSTANALRISCASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVNSSPYEEGWLIKVKPSSPSDLESLMDPQAYT 492
            MALRMWASSTANALR+S A++     LSRCFSSVLDGLKYA+SHEWVKHEGSVATVGITDHAQDHLGEVVFV+LPE G SV +  GFG VESVKATSDVNSPISGE++EVN+KL+ETPGL+NSSPYE+GW+IKVKPS+PS+L+SLM  + YT
Sbjct:    1 MALRMWASSTANALRLSSATRPHYSPLSRCFSSVLDGLKYANSHEWVKHEGSVATVGITDHAQDHLGEVVFVDLPEAGGSVTKATGFGAVESVKATSDVNSPISGEIVEVNSKLSETPGLINSSPYEDGWMIKVKPSNPSELDSLMGAKEYT 152          
The following BLAST results are available for this feature:
BLAST of CX299943 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 461
Match NameE-valueIdentityDescription
GCSH_FLAAN1.930e-7179.01Glycine cleavage system H protein, mitochondrial O... [more]
GCSH_FLAPR1.251e-7077.78Glycine cleavage system H protein, mitochondrial O... [more]
GCSH_PEA1.634e-7077.58Glycine cleavage system H protein, mitochondrial O... [more]
GCSH2_ARATH3.640e-7078.31Probable glycine cleavage system H protein 2, mito... [more]
GCSH_ORYSJ8.965e-6976.07Glycine cleavage system H protein, mitochondrial O... [more]
GCSH_ORYSI8.965e-6976.07Glycine cleavage system H protein, mitochondrial O... [more]
GCSH_FLATR3.407e-6877.30Glycine cleavage system H protein, mitochondrial O... [more]
GCSH1_ARATH1.431e-6674.55Glycine cleavage system H protein 1, mitochondrial... [more]
GCSH_MESCR1.582e-6575.46Glycine cleavage system H protein, mitochondrial O... [more]
GCSH_FLAPU1.582e-6578.95Glycine cleavage system H protein, mitochondrial (... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004C07SK SaltLeaf1 Citrus clementina cDNA clone C07004C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299943 ID=CX299943|Name=CX299943|organism=Citrus clementina|type=EST|length=610bp
GACTTGGAGCTACTGAAAAAATAAAGCAAATAAGGCATGGCACTCAGAAT
GTGGGCGTCGTCTACTGCCAATGCTCTTAGAATTTCCTGCGCCTCCAAAA
CTCCTGCATTTGCCCTCTCCAGATGCTTCTCTTCTGTCTTGGATGGGTTG
AAATATGCATCCTCGCATGAATGGGTGAAGCATGAAGGCTCTGTGGCTAC
TGTTGGCATCACTGATCATGCCCAGGATCATCTTGGAGAAGTAGTGTTTG
TGGAGCTGCCAGAAACTGGTGCCTCAGTCAAACAAGGCGGCGGCTTCGGG
GTTGTAGAAAGTGTGAAAGCAACCAGTGACGTTAATTCCCCCATTTCTGG
TGAAGTTATTGAGGTTAACACCAAGCTCACTGAAACGCCTGGCTTGGTCA
ATTCAAGCCCATATGAAGAAGGATGGCTGATAAAGGTGAAGCCTAGCAGC
CCTTCGGATTTAGAATCCTTGATGGATCCACAGGCTTACACGAAATTTTG
CGAAGAAGAAAATGCAGCTCATTAGAATCTTCACATTGTTTCATTTTCTT
TTCCCAAAACATACTAATAAATCTCTTTGTTTTACTCGCTAAAAAAAAAA
AAAAAAAAAA
back to top