CX299956

Overview
NameCX299956
Unique NameCX299956
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length622
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6016 contig Ccv1_Contig6016:991..1612. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299956 vs. ExPASy Swiss-Prot
Match: YG41_SCHPO (Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe GN=SPBC23E6.01c PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 3.112e-16
Identity = 38/62 (61.29%), Postives = 48/62 (77.42%), Query Frame = 1
Query:    4 VSDEDLREPFSQFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRN 189
            VS+E+L+  F  FGEI+ VKIP GKGCGFVQF NR+ AE+A+ +LQG  +G   +RLSWGRN
Sbjct:  314 VSEEELKYLFQNFGEIVYVKIPPGKGCGFVQFVNRQSAEIAINQLQGYPLGNSRIRLSWGRN 375          
BLAST of CX299956 vs. ExPASy Swiss-Prot
Match: CSX1_SCHPO (RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe GN=csx1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.087e-12
Identity = 30/63 (47.62%), Postives = 45/63 (71.43%), Query Frame = 1
Query:    1 DVSDEDLREPFSQFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRN 189
            ++S++DL+  F  FG IL++KIP GKGCGFVQ++ +  AE A+  +QG  +G   +RL+WG N
Sbjct:  307 NLSEKDLQVCFQPFGRILNIKIPFGKGCGFVQYSEKSAAEKAINTMQGALVGTSHIRLAWGHN 369          
BLAST of CX299956 vs. ExPASy Swiss-Prot
Match: NAM8_YEAST (Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.353e-11
Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 1
Query:    4 VSDEDLREPFSQFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGRN 189
            V++++LR  F  FG I+ VKIPVGK CGFVQ+ +R  AE A+  +QG  I    VRLSWGR+
Sbjct:  324 VTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRS 385          
BLAST of CX299956 vs. ExPASy Swiss-Prot
Match: NGR1_YEAST (Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae GN=NGR1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.014e-11
Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 1
Query:   19 LREPFSQFGEILSVKIPVGKGCGFVQFANRKDAEVALQKLQGTAIGKQTVRLSWGR 186
            LR  F  FG IL+V+IP GK CGFV+F  R DAE ++Q LQG  +G   +RLSWGR
Sbjct:  376 LRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGR 431          
The following BLAST results are available for this feature:
BLAST of CX299956 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
YG41_SCHPO3.112e-1661.29Uncharacterized RNA-binding protein C23E6.01c OS=S... [more]
CSX1_SCHPO2.087e-1247.62RNA-binding post-transcriptional regulator csx1 OS... [more]
NAM8_YEAST1.353e-1153.23Protein NAM8 OS=Saccharomyces cerevisiae GN=NAM8 P... [more]
NGR1_YEAST3.014e-1157.14Negative growth regulatory protein NGR1 OS=Sacchar... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004D09SK SaltLeaf1 Citrus clementina cDNA clone C07004D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299956 ID=CX299956|Name=CX299956|organism=Citrus clementina|type=EST|length=622bp
GATGTCAGTGATGAGGATCTCAGAGAGCCTTTTTCTCAGTTTGGTGAGAT
TCTTTCTGTTAAAATACCTGTTGGTAAAGGATGTGGATTTGTGCAATTTG
CAAACAGAAAGGATGCTGAGGTTGCATTGCAGAAGTTACAAGGGACCGCT
ATAGGCAAGCAAACAGTCCGTCTTTCTTGGGGTCGCAATCCTGGGAACAA
ACAGTGGAGAGGAGATCACAGTAACCACTGGAATGGGGCACACTATGGAG
GTCAGGGCTATAGTGGCAATGGATATGCTTTTCCGCCAAATCAAGATCCA
AACATGTATGCTGCAACAGCGGTTCCCGGTGCTTCTTAAGAAGTATGAGG
GTAGTACGACACCGTGTAATCTGAACTTGCTGAACTGGCTGAAATTACCC
AATGAGATCTATGAACTAAAGTAGGATGGATTTTGCTGCTGAATATGTAG
CTAAATCTGTAGTTTGCAGAATTTTGTAGCTGGAATATACTTAATAGCTT
GGAGATGTGTGAGGCTTGTATTATTATTTTTCATTCTTGGGGAGTCTGTT
TGAGAGGGATTGTTATGTTTGTGTTTCTGAACTAAACTCAAGAGGAGAAT
GCCAAGAACAGAACTCTTGAAT
back to top