CX299959

Overview
NameCX299959
Unique NameCX299959
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX299959_ssr310 microsatellite CX299959_ssr310:310..321. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.822e-22
Identity = 61/170 (35.88%), Postives = 89/170 (52.35%), Query Frame = 2
Query:    5 LWDRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINVQ 514
            L D     RT++QM++TMDRM E+    SG       +  G   S  R PW+IKE E+E  MRFDMPG++K+DVK+ VE+ +L                                  WS +S   Y +R+ LP+N + DKI AE+K+GVL++TIPK      +++D+ +Q
Sbjct:   85 LLDPLSPMRTMRQMLDTMDRMFEDTMPVSGR------NRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVL--------------------VIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVER-KVIDVQIQ 227          
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS21C_PEA (Small heat shock protein, chloroplastic OS=Pisum sativum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.829e-21
Identity = 61/170 (35.88%), Postives = 89/170 (52.35%), Query Frame = 2
Query:    5 LWDRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINVQ 514
            L D +   R+++QM++TMDR+ E+     G          GG     R PWEIK+ E+E  MRFDMPG++K+DVKV VE+ +L             +                    WS KSY  Y +R+ LP+N + +K+ AE+KDGVLY+TIPK       ++D+ +Q
Sbjct:   92 LLDPWSPMRSMRQMLDTMDRIFEDAITIPGR-------NIGG--GEIRVPWEIKDEEHEIRMRFDMPGVSKEDVKVSVEDDVLVIKSDHREENGGEDC-------------------WSRKSYSCYDTRLKLPDNCEKEKVKAELKDGVLYITIPKTKIER-TVIDVQIQ 232          
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.120e-21
Identity = 58/168 (34.52%), Postives = 89/168 (52.98%), Query Frame = 2
Query:   11 DRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINVQ 514
            D +   R+++Q+++TMDR+ E+   + G          GG     R PW+IK+ E+E  MRFDMPG+ K+DVKV VE+ ML                                  WS+++Y  Y +R+ LP+N + DK+ AE+K+GVLY+TIPK      +++D+ VQ
Sbjct:   41 DPWSPMRSMRQILDTMDRVFEDTMTFPGR-------NIGG--GEIRAPWDIKDEEHEIRMRFDMPGLAKEDVKVSVEDDML-----------------VIKGGHKSEQEHGGDDSWSSRTYSSYDTRLKLPDNCEKDKVKAELKNGVLYITIPKTKVER-KVIDVQVQ 181          
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS21C_SOLLC (Small heat shock protein, chloroplastic OS=Solanum lycopersicum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.884e-20
Identity = 59/167 (35.33%), Postives = 90/167 (53.89%), Query Frame = 2
Query:   11 DRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINV 511
            D     RT++QM++TMDR+ E+   + G   +   S TG      RTPW+I + ENE  MRFDMPG++K+DVKV VE  ML             +                    W  ++Y  Y +R++LP+NV  DKI AE+K+GVL+++IPK +    +++D+ +
Sbjct:   94 DPMSPMRTMRQMIDTMDRLFEDTMTFPGRNRA---SGTGEI----RTPWDIHDDENEIKMRFDMPGLSKEDVKVSVENDMLVIKGEHKKEEDGRDKH-----------------SW-GRNYSSYDTRLSLPDNVVKDKIKAELKNGVLFISIPK-TEVEKKVIDVQI 234          
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.712e-19
Identity = 58/170 (34.12%), Postives = 89/170 (52.35%), Query Frame = 2
Query:    5 LWDRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINVQ 514
            L D     RT++QMM+TMDR+ E+      T+P      TG      R PW+IK+ ENE  MRFDMPG++K++VKV VE+ +L             +                   D   ++Y  Y +R++LP+NV  DK+ AE+K+GVL ++IPK      ++ D+ ++
Sbjct:  100 LLDPMSPMRTMRQMMDTMDRLFEDTM----TFPGSRNRGTGEI----RAPWDIKDDENEIKMRFDMPGLSKEEVKVSVEDDVLVIKGEHKKEESGKD-------------------DSWGRNYSSYDTRLSLPDNVDKDKVKAELKNGVLLISIPKTKVEK-KVTDVEIK 241          
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS21C_WHEAT (Small heat shock protein, chloroplastic OS=Triticum aestivum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.947e-16
Identity = 52/170 (30.59%), Postives = 84/170 (49.41%), Query Frame = 2
Query:    5 LWDRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINVQ 514
            L D     RT++QM++TMDR+ ++   +  T  SP         +R R PW+I E E E  MRFDMPG+++++V+V VE+  L             + +                  W  +S   Y  R+ALP+     ++ AE+K+GVL V++PK      +++D+ VQ
Sbjct:   90 LVDPMSPMRTMRQMLDTMDRLFDDAVGFP-TRRSPAA------RARRRMPWDIMEDEKEVKMRFDMPGLSREEVRVMVEDDALVIRGEHKKEAGEGQGEGGDGW-------------WKERSVSSYDMRLALPDECDKSQVRAELKNGVLLVSVPK-RETERKVIDVQVQ 238          
BLAST of CX299959 vs. ExPASy Swiss-Prot
Match: HS26P_ORYSJ (26.7 kDa heat shock protein, chloroplastic OS=Oryza sativa subsp. japonica GN=HSP26.7 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.699e-15
Identity = 53/170 (31.18%), Postives = 82/170 (48.24%), Query Frame = 2
Query:    5 LWDRFPTARTVQQMMETMDRMLEEPFAYSGTWPSPLPSETGGFNSRGRTPWEIKEGENEYTMRFDMPGMTKQDVKVWVEEKMLXXXXXXXXXXXXXETQVXXXXXXXXXXXXXXXXDWSAKSYGRYSSRIALPENVQFDKITAEVKDGVLYVTIPKPSHNNGRILDINVQ 514
            L D     RT++QM++TMDR+ ++     G   +P  S   G     R PW++ E + E  MRFDMPG+++++VKV VE+  L                                  W  +S   Y  R+ALP+     K+ AE+K+GVL VT+PK +    +++D+ VQ
Sbjct:   90 LVDPMSPMRTMRQMLDTMDRIFDD--VALGFPATPRRSLATG---EVRMPWDVMEDDKEVRMRFDMPGLSREEVKVMVEDDALVIRGEHKKEEGEGAEGSGDGW-------------WKERSVSSYDMRLALPDECDKSKVRAELKNGVLLVTVPK-TEVERKVIDVQVQ 240          
The following BLAST results are available for this feature:
BLAST of CX299959 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
HS25P_ARATH2.822e-2235.8825.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS21C_PEA1.829e-2135.88Small heat shock protein, chloroplastic OS=Pisum s... [more]
HS22C_SOYBN3.120e-2134.52Small heat shock protein, chloroplastic (Fragment)... [more]
HS21C_SOLLC5.884e-2035.33Small heat shock protein, chloroplastic OS=Solanum... [more]
HS22C_PETHY1.712e-1934.12Small heat shock protein, chloroplastic OS=Petunia... [more]
HS21C_WHEAT3.947e-1630.59Small heat shock protein, chloroplastic OS=Triticu... [more]
HS26P_ORYSJ5.699e-1531.1826.7 kDa heat shock protein, chloroplastic OS=Oryz... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004E01SK SaltLeaf1 Citrus clementina cDNA clone C07004E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299959 ID=CX299959|Name=CX299959|organism=Citrus clementina|type=EST|length=703bp
CAGGTTATGGGACCGGTTTCCTACAGCAAGAACAGTGCAGCAGATGATGG
AGACAATGGACAGGATGTTGGAGGAGCCATTCGCTTACTCGGGGACATGG
CCATCGCCTTTGCCAAGCGAGACAGGAGGGTTTAACAGCAGAGGAAGAAC
TCCGTGGGAGATAAAAGAGGGGGAGAATGAGTACACGATGAGATTTGACA
TGCCCGGCATGACTAAACAAGACGTTAAGGTCTGGGTTGAAGAGAAAATG
TTGGTTGTCAAAGCTCAAAAAGTACCCAAAAACAAAAAGAAAGAAACCCA
AGTGAACAGTAATAATAATAATGGCAATGGCGAAGCTGATGAAGAAGAAG
GAGACTGGTCTGCTAAAAGTTATGGGAGGTACAGCAGCAGGATTGCATTG
CCTGAGAATGTTCAGTTTGACAAGATTACAGCTGAGGTTAAAGATGGGGT
TTTGTATGTAACCATACCTAAGCCTAGTCATAATAATGGTAGAATTTTGG
ATATCAACGTCCAATAATATGACCAATGGTTCCGAAGTGGTGTTTGCTTT
TCTGTCTTTGTTTTTGAAATTATTTTCGGTATGAATCTGAGCTGTTTGTG
TAATAGATAGAAATAAATGTCTACAGATGTGGCCACGAACGAAGTATTTT
ATGTAGTGCATGTTCCACCAAAAAAAAAAAAAAAAAAACTCGAGGGGGGG
CCC
back to top