CX300108
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300108 vs. ExPASy Swiss-Prot
Match: RL20_DEIRA (50S ribosomal protein L20 OS=Deinococcus radiodurans GN=rplT PE=1 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.176e-13 Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 2 Query: 56 RRINAGSRHHGVNYGDFMHGLMRENIQLNWKVLSKLSMHEPYRFKALVYICRPA 217 +RINAG+R HG+NY F++GL R NI LN KVL+ ++ EP FKALV R A Sbjct: 63 QRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKALVDASRNA 116 HSP 2 Score: 35.8094 bits (81), Expect = 1.176e-13 Identity = 15/19 (78.95%), Postives = 15/19 (78.95%), Query Frame = 1 Query: 1 YSY*DRRNKKRDMRSLWIQ 57 Y Y DRRNKKRD R LWIQ Sbjct: 45 YEYRDRRNKKRDFRRLWIQ 63
BLAST of CX300108 vs. ExPASy Swiss-Prot
Match: RL20_RHOCS (50S ribosomal protein L20 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplT PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 7.326e-13 Identity = 27/48 (56.25%), Postives = 35/48 (72.92%), Query Frame = 2 Query: 56 RRINAGSRHHGVNYGDFMHGLMRENIQLNWKVLSKLSMHEPYRFKALV 199 +RINAG+R HG+ Y FMHGL R I+++ KVLS ++ EP FKALV Sbjct: 63 QRINAGARLHGLTYSKFMHGLKRAGIEVDRKVLSDIAAREPESFKALV 110 HSP 2 Score: 35.4242 bits (80), Expect = 7.326e-13 Identity = 14/19 (73.68%), Postives = 16/19 (84.21%), Query Frame = 1 Query: 1 YSY*DRRNKKRDMRSLWIQ 57 Y+Y DRRN+KRD R LWIQ Sbjct: 45 YAYRDRRNRKRDFRGLWIQ 63
BLAST of CX300108 vs. ExPASy Swiss-Prot
Match: RL20_DEIDV (50S ribosomal protein L20 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rplT PE=3 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 3.534e-12 Identity = 26/48 (54.17%), Postives = 34/48 (70.83%), Query Frame = 2 Query: 56 RRINAGSRHHGVNYGDFMHGLMRENIQLNWKVLSKLSMHEPYRFKALV 199 +RINAG+R HG+NY F+ GL R + LN KVL+ ++ EP FKALV Sbjct: 63 QRINAGARLHGMNYSTFIGGLKRAGVDLNRKVLADIAAREPEAFKALV 110 HSP 2 Score: 35.4242 bits (80), Expect = 3.534e-12 Identity = 14/19 (73.68%), Postives = 15/19 (78.95%), Query Frame = 1 Query: 1 YSY*DRRNKKRDMRSLWIQ 57 Y Y DRRNKKRD R LW+Q Sbjct: 45 YEYRDRRNKKRDFRRLWVQ 63
BLAST of CX300108 vs. ExPASy Swiss-Prot
Match: RL20_DEIGD (50S ribosomal protein L20 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplT PE=3 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 2.195e-11 Identity = 25/57 (43.86%), Postives = 37/57 (64.91%), Query Frame = 2 Query: 56 RRINAGSRHHGVNYGDFMHGLMRENIQLNWKVLSKLSMHEPYRFKALVYICRPAFSG 226 +RINAG+R HG+NY F++GL + LN KVL+ ++ EP F+ LV + A +G Sbjct: 63 QRINAGARLHGMNYSTFINGLKVAGVDLNRKVLADIAAREPEAFQVLVNTAKGARNG 119 HSP 2 Score: 35.8094 bits (81), Expect = 2.195e-11 Identity = 15/19 (78.95%), Postives = 15/19 (78.95%), Query Frame = 1 Query: 1 YSY*DRRNKKRDMRSLWIQ 57 Y Y DRRNKKRD R LWIQ Sbjct: 45 YEYRDRRNKKRDFRRLWIQ 63
BLAST of CX300108 vs. ExPASy Swiss-Prot
Match: RL20_MARMM (50S ribosomal protein L20 OS=Maricaulis maris (strain MCS10) GN=rplT PE=3 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 2.203e-11 Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 2 Query: 56 RRINAGSRHHGVNYGDFMHGLMRENIQLNWKVLSKLSMHEPYRFKALVYICRPA 217 +RINAG+R H ++Y FM+GL + I+++ KVL+ ++MHEP FKALV R A Sbjct: 63 QRINAGARQHEMSYSVFMNGLTKAGIEVDRKVLADIAMHEPDAFKALVDQARAA 116 HSP 2 Score: 31.9574 bits (71), Expect = 2.203e-11 Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 1 Query: 1 YSY*DRRNKKRDMRSLWIQ 57 Y+Y DRR KKR+ R+LWIQ Sbjct: 45 YAYRDRRAKKRNFRALWIQ 63
BLAST of CX300108 vs. ExPASy Swiss-Prot
Match: RL20_MESSB (50S ribosomal protein L20 OS=Mesorhizobium sp. (strain BNC1) GN=rplT PE=3 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 8.012e-11 Identity = 25/60 (41.67%), Postives = 39/60 (65.00%), Query Frame = 2 Query: 56 RRINAGSRHHGVNYGDFMHGLMRENIQLNWKVLSKLSMHEPYRFKALVYICRPAFSGNKN 235 +RINA +R HG+ YG F+ GL + I+++ KVL+ +++HEP F ALV + + KN Sbjct: 63 QRINAATREHGLTYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVAKSKASLEYLKN 122 HSP 2 Score: 32.7278 bits (73), Expect = 8.012e-11 Identity = 12/19 (63.16%), Postives = 17/19 (89.47%), Query Frame = 1 Query: 1 YSY*DRRNKKRDMRSLWIQ 57 Y+Y DR+N+KR+ R+LWIQ Sbjct: 45 YAYRDRKNRKRNFRALWIQ 63 The following BLAST results are available for this feature:
BLAST of CX300108 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300108 ID=CX300108; Name=CX300108; organism=Citrus clementina; type=EST; length=334bpback to top |