CX309040
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: TLP_ACTDE (Thaumatin-like protein OS=Actinidia deliciosa GN=tlp PE=1 SV=2) HSP 1 Score: 99.3673 bits (246), Expect = 6.182e-21 Identity = 42/49 (85.71%), Postives = 43/49 (87.76%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CCNSGNCG T FSKFFKDR PD YSYPKDD TSTFTCP GT+YKVVFCP Sbjct: 177 CCNSGNCGLTNFSKFFKDRCPDAYSYPKDDQTSTFTCPAGTNYKVVFCP 225
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: P21_SOYBN (Protein P21 OS=Glycine max PE=1 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 2.872e-18 Identity = 37/49 (75.51%), Postives = 41/49 (83.67%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CCNSG+CGPT +S+FFK R PD YSYPKDD STFTC GTDY+VVFCP Sbjct: 154 CCNSGSCGPTDYSRFFKQRCPDAYSYPKDDPPSTFTCNGGTDYRVVFCP 202
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: OSMO_TOBAC (Osmotin OS=Nicotiana tabacum GN=AP24 PE=1 SV=2) HSP 1 Score: 84.3445 bits (207), Expect = 2.058e-16 Identity = 36/50 (72.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTG-TDYKVVFCP 147 CC G CGPT FSKFFK R PD YSYP+DD TSTFTCP G T+Y+V+FCP Sbjct: 177 CCTQGPCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYRVIFCP 226
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: OS81_SOLCO (Osmotin-like protein OSML81 OS=Solanum commersonii PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 3.511e-16 Identity = 36/50 (72.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTG-TDYKVVFCP 147 CC G CGPT SKFFK R PD YSYP+DD TSTFTCP+G T+Y+VVFCP Sbjct: 177 CCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFCP 226
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: TPM1_SOLLC (Osmotin-like protein TPM-1 (Fragment) OS=Solanum lycopersicum GN=TPM-1 PE=2 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 4.585e-16 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTG-TDYKVVFCP 147 CC G CGPT S+FFK R PD YSYP+DD TSTFTCP+G T+Y+VVFCP Sbjct: 169 CCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFCP 218
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: OS13_SOLCO (Osmotin-like protein OSML13 OS=Solanum commersonii PE=2 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 4.585e-16 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTG-TDYKVVFCP 147 CC G CGPT S+FFK R PD YSYP+DD TSTFTCP+G T+Y+VVFCP Sbjct: 177 CCTQGPCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFCP 226
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: PRR1_TOBAC (Pathogenesis-related protein R major form OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 5.988e-16 Identity = 34/51 (66.67%), Postives = 42/51 (82.35%), Query Frame = 1 Query: 1 CCNSG--NCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC +G +CGPT S+FFK+R PD YSYP+DD TS FTCP+GT+Y+VVFCP Sbjct: 176 CCTNGPGSCGPTDLSRFFKERCPDAYSYPQDDPTSLFTCPSGTNYRVVFCP 226
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: NP24_SOLLC (Protein NP24 OS=Solanum lycopersicum PE=1 SV=2) HSP 1 Score: 82.4185 bits (202), Expect = 7.821e-16 Identity = 36/50 (72.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 1 CCNSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTG-TDYKVVFCP 147 CC G CGPT SKFFK R PD YSYP+DD TSTFTCP G T+Y+VVFCP Sbjct: 177 CCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCP 226
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: IAAT_MAIZE (Alpha-amylase/trypsin inhibitor OS=Zea mays PE=1 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 7.821e-16 Identity = 35/52 (67.31%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 CC---NSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC + NC PT +S++FK + PD YSYPKDDATSTFTCP GT+YKVVFCP Sbjct: 155 CCVGSAANNCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP 206
BLAST of CX309040 vs. ExPASy Swiss-Prot
Match: ZEAM_MAIZE (Zeamatin OS=Zea mays GN=Zlp PE=1 SV=2) HSP 1 Score: 80.4925 bits (197), Expect = 2.972e-15 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 CC---NSGNCGPTGFSKFFKDRGPDVYSYPKDDATSTFTCPTGTDYKVVFCP 147 CC + +C PT +S++FK + PD YSYPKDDATSTFTCP GT+YKVVFCP Sbjct: 176 CCVGSAANDCHPTNYSRYFKGQCPDAYSYPKDDATSTFTCPAGTNYKVVFCP 227 The following BLAST results are available for this feature:
BLAST of CX309040 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX309040 ID=CX309040; Name=CX309040; organism=Citrus clementina; type=EST; length=378bpback to top |