DY259743
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY259743 vs. ExPASy Swiss-Prot
Match: ATP5E_ARATH (ATP synthase subunit epsilon, mitochondrial OS=Arabidopsis thaliana GN=At1g51650 PE=1 SV=3) HSP 1 Score: 83.5741 bits (205), Expect = 1.624e-20 Identity = 39/45 (86.67%), Postives = 42/45 (93.33%), Query Frame = 3 Query: 72 MDSNAAVPFWRAAGMRYISYSNICANLVRNCLKEP*KSEALTREE 206 M SNAAVPFWRAAGM YISYSNICAN+VRNCLKEP K+EALTRE+ Sbjct: 1 MASNAAVPFWRAAGMTYISYSNICANIVRNCLKEPHKAEALTREK 45 HSP 2 Score: 37.7354 bits (86), Expect = 1.624e-20 Identity = 16/25 (64.00%), Postives = 17/25 (68.00%), Query Frame = 1 Query: 181 KARPSLARKVHFSISKWTDGIPQKP 255 KA KVHFS+SKW DG PQKP Sbjct: 37 KAEALTREKVHFSLSKWADGKPQKP 61
BLAST of DY259743 vs. ExPASy Swiss-Prot
Match: ATP5E_IPOBA (ATP synthase subunit epsilon, mitochondrial OS=Ipomoea batatas PE=1 SV=2) HSP 1 Score: 78.9518 bits (193), Expect = 1.421e-18 Identity = 35/45 (77.78%), Postives = 42/45 (93.33%), Query Frame = 3 Query: 72 MDSNAAVPFWRAAGMRYISYSNICANLVRNCLKEP*KSEALTREE 206 M SNAAVPFWRAAGM YI+YSN+CAN+VRNCLKEP ++EAL+RE+ Sbjct: 1 MASNAAVPFWRAAGMTYITYSNLCANMVRNCLKEPYRAEALSREK 45 HSP 2 Score: 35.8094 bits (81), Expect = 1.421e-18 Identity = 14/18 (77.78%), Postives = 15/18 (83.33%), Query Frame = 1 Query: 205 KVHFSISKWTDGIPQKPS 258 KVHFS SKW DG PQKP+ Sbjct: 45 KVHFSFSKWVDGKPQKPA 62
BLAST of DY259743 vs. ExPASy Swiss-Prot
Match: ATP5E_MAIZE (ATP synthase subunit epsilon, mitochondrial OS=Zea mays PE=3 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 7.323e-17 Identity = 34/43 (79.07%), Postives = 37/43 (86.05%), Query Frame = 3 Query: 78 SNAAVPFWRAAGMRYISYSNICANLVRNCLKEP*KSEALTREE 206 + AAVPFWRAAGM YI YSNICA LVRNCLKEP KSEA +RE+ Sbjct: 4 TTAAVPFWRAAGMTYIGYSNICAALVRNCLKEPFKSEAASREK 46 HSP 2 Score: 36.1946 bits (82), Expect = 7.323e-17 Identity = 15/26 (57.69%), Postives = 19/26 (73.08%), Query Frame = 1 Query: 181 KARPSLARKVHFSISKWTDGIPQKPS 258 K+ + KVHFSISKWTDG +KP+ Sbjct: 38 KSEAASREKVHFSISKWTDGKQEKPT 63 The following BLAST results are available for this feature:
BLAST of DY259743 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY259743 ID=DY259743; Name=DY259743; organism=Citrus clementina; type=EST; length=1042bpback to top |