DY262455

Overview
NameDY262455
Unique NameDY262455
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1321
Libraries
Library NameType
CitNFLcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DY262455_ssr57 microsatellite DY262455_ssr57:57..71. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: VPS91_SCHPO (Vacuolar protein sorting-associated protein 9a OS=Schizosaccharomyces pombe GN=vps901 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.927e-22
Identity = 52/200 (26.00%), Postives = 104/200 (52.00%), Query Frame = 3
Query:  102 FYDFLDRMRNPASLDLVRSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTF------------ASTSEDVKIDQEISEKICLLQTFLRPEHLDIPTFLQNEASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            F+ FL+++R+ ++  + + +KSF+  F+          K +++F   +   I+ +  WA+ +   I++A EG+EK V+ +L++  F            +  S+DV+ D+ +SEK+ L Q ++  E+LDI     +   + LA  EL++IN   APR+K+                + +   V+   AD F+P+LI+++++
Sbjct:  115 FHMFLEQLRSSSAEPVAKYLKSFLSEFTKRRWTVNYQVKLIRDFLKFINEKIEQYEPWASGSQAEIDNAKEGMEKLVLNRLYTSLFSPEIAKSGIPLSSEHSDDVEEDRVLSEKMELFQ-WITEENLDIKKQKSSSKFFKLAADELRRINDYHAPRDKI-----ICLLNCCKVIFSYLRNVVKEESADMFVPILIFVVLQ 308          

HSP 2 Score: 46.9802 bits (110), Expect = 6.927e-22
Identity = 23/62 (37.10%), Postives = 35/62 (56.45%), Query Frame = 1
Query:  712 VHANPPQLHSNIKFIQLYRRQAMLVSEAAYYFTNLVSAKTFILDLNAKSLSMEETEFEKSMQ 897
            + A P  L SNI++IQ +R    L  E  YY + L+ A +FI  L+  SL++ E EF   ++
Sbjct:  307 LQARPAHLVSNIQYIQRFRSPEKLTGEVMYYLSTLMGAMSFIETLDCSSLTITEEEFNAQIE 368          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: VPS9_YEAST (Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae GN=VPS9 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.551e-17
Identity = 62/214 (28.97%), Postives = 99/214 (46.26%), Query Frame = 3
Query:  102 FYDF---LDRMRNPASLDLVRSIKSFIVSFSFNNA--NPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFAST-------------SEDVKIDQEISEKICLLQTFLRPEHLDIPTFLQN---EASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIKLQDQF 680
            FYDF   + +++ P +  LV+  KSF+ +F           + K + +F T +      +  + +     + +A EG+EK +M KL+SR F+ +              +D+  D  + EKI   + F+ P  LDIP  + N        LA KEL KIN  K+PR+K+                  + +N    GAD F+PVLIY I+K Q ++
Sbjct:   60 FYDFQIFIKQLQTPGADPLVKYTKSFLRNFLAQRLLWTVSEEIKLISDFKTFIYDKFTLYEPFRSLDNSKMRNAKEGMEKLIMGKLYSRCFSPSLYEILQKPLDDEHMKDLTNDDTLLEKIRHYR-FISPIMLDIPDTMPNARLNKFVHLASKELGKINRFKSPRDKMVCVLNASKVIFGLLKHTKLEQN----GADSFIPVLIYCILKGQVRY 268          

HSP 2 Score: 38.1206 bits (87), Expect = 2.551e-17
Identity = 19/56 (33.93%), Postives = 35/56 (62.50%), Query Frame = 1
Query:  733 LHSNIKFIQLYRRQAMLVSEAAYYFTNLVSAKTFILDLNAKSLSMEETE-FEKSMQ 897
            L SN+ +I+ +R    +  E  YY ++L +A  FI+ L  +SL++++ E FE++ Q
Sbjct:  269 LVSNVNYIERFRSPDFIRGEEEYYLSSLQAALNFIMSLTERSLTIDDHEDFEEAYQ 324          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: RABX5_BOVIN (Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABGEF1 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 7.698e-16
Identity = 48/193 (24.87%), Postives = 93/193 (48.19%), Query Frame = 3
Query:  102 FYDFLDRMRNPASLDLVRSIKSFIVSFSFN-NANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFA-STSEDVKIDQEISEKICLLQTFLRPEHLDIPTFLQ-NEASWLL--AEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            F +FL         ++ +  K F+ +  +  + + E   +  Q+F+  +   ++          E +E  M+ +EKY+MT+L+   F   T++D K D  I ++I  L  ++ P+ L +P   +  E S ++  A  ++ ++++ + PR+K+                  I++N E   ADDFLP LIYI++K
Sbjct:  143 FIEFLKTFHKTGQ-EIYKQTKLFLEAMHYKRDLSIEEQSECTQDFYQNVAERMQTR---GKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALH-WVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKL---ACITKCSKHIFNAIKITKN-EPASADDFLPTLIYIVLK 326          

HSP 2 Score: 52.7582 bits (125), Expect = 7.698e-16
Identity = 27/67 (40.30%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  721 NPPQLHSNIKFIQLYRRQAMLVS-EAAYYFTNLVSAKTFILDLNAKSLSMEETEFEKSMQAARLPTK 918
            NPP+L SNI++I  +   + L++ E  YYFTNL  A  FI  L+A+SL++ + +F++ M     P K
Sbjct:  328 NPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRK 394          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: RABX5_MOUSE (Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Rabgef1 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.300e-15
Identity = 27/67 (40.30%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  721 NPPQLHSNIKFIQLYRRQAMLVS-EAAYYFTNLVSAKTFILDLNAKSLSMEETEFEKSMQAARLPTK 918
            NPP+L SNI++I  +   + L++ E  YYFTNL  A  FI  L+A+SL++ + +F++ M     P K
Sbjct:  327 NPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRK 393          

HSP 2 Score: 52.373 bits (124), Expect = 1.300e-15
Identity = 47/193 (24.35%), Postives = 93/193 (48.19%), Query Frame = 3
Query:  102 FYDFLDRMRNPASLDLVRSIKSFIVSFSFN-NANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFA-STSEDVKIDQEISEKICLLQTFLRPEHLDIPTFLQ-NEASWLLAEK--ELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            F DFL         ++ +  K F+ +  +  + + E   +  Q+F+  +   ++          E +E  M+ +EK++MT+L+   F   T++D K D  I ++I  L  ++ P+ L +P   +  E S ++ +   ++ ++++ + PR+K+                  I++N E   ADDFLP LIYI++K
Sbjct:  142 FIDFLKTFHKTGQ-EVYKQTKMFLEAMPYKRDLSIEEQSECTQDFYQNVAERMQTR---GKVPPEKVEKIMDQIEKHIMTRLYKFVFCPETTDDEKKDLAIQKRIRALH-WVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITRCSKHIFNAI---KITKN-EPASADDFLPTLIYIVLK 325          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: RABX5_HUMAN (Rab5 GDP/GTP exchange factor OS=Homo sapiens GN=RABGEF1 PE=1 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 2.829e-15
Identity = 27/67 (40.30%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  721 NPPQLHSNIKFIQLYRRQAMLVS-EAAYYFTNLVSAKTFILDLNAKSLSMEETEFEKSMQAARLPTK 918
            NPP+L SNI++I  +   + L++ E  YYFTNL  A  FI  L+A+SL++ + +F++ M     P K
Sbjct:  544 NPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRK 610          

HSP 2 Score: 51.2174 bits (121), Expect = 2.829e-15
Identity = 38/129 (29.46%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  291 EAIESAMEGLEKYVMTKLFSRTFA-STSEDVKIDQEISEKICLLQTFLRPEHLDIPT---FLQNEASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            E +E  M+ +EKY+MT+L+   F   T++D K D  I ++I  L+ ++ P+ L +P      +     + A  ++ ++++ + PR+K+                  I++N E   ADDFLP LIYI++K
Sbjct:  419 ERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALR-WVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKL---ACITKCSKHIFNAIKITKN-EPASADDFLPTLIYIVLK 542          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: GAPD1_XENLA (GTPase-activating protein and VPS9 domain-containing protein 1 OS=Xenopus laevis GN=gapvd1 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.235e-13
Identity = 51/172 (29.65%), Postives = 83/172 (48.26%), Query Frame = 3
Query:  159 IKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFASTSE-DVKIDQEISEKICLLQTFLRPEH--LDIPTFLQNEASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            I  FI  F    A  +   + V+EF  ++  A+    +W NA+ E ++ A   +E+ +M ++F   F    + D+  DQ + E I  L   +   H  L IP     EA W  A+ E++ I+A K PR+KV                 S++    + GADDF+PVL++++IK
Sbjct: 1239 IHEFIQDFQKLTAADDKTAQ-VEEFLQSLYGAMAQDVIWQNASEEQLQDAQIAIERSIMNRIFKLAFNPNQDADILRDQVLHEHIKRLSKVVTANHRALQIPEVYLREAPWPSAQTEIRTISAYKTPRDKV---QCILRMCSTIMNLLSLANEYSVPGADDFVPVLVFVLIK 1406          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: GAPD1_HUMAN (GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens GN=GAPVD1 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.613e-13
Identity = 51/174 (29.31%), Postives = 84/174 (48.28%), Query Frame = 3
Query:  153 RSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFASTSE-DVKIDQEISEKICLLQTFLRPEH--LDIPTFLQNEASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            + I+ FI  F    A  +   + V++F   +  A+    +W NA+ E ++ A   +E+ VM ++F   F    + D+  DQ + E I  L   +   H  L IP     EA W  A+ E++ I+A K PR+KV                 S++    + GADDF+PVL++++IK
Sbjct: 1263 KKIREFIQDFQKLTAADDKTAQ-VEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVMNRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSEIRTISAYKTPRDKV---QCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIK 1432          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: GAPD1_BOVIN (GTPase-activating protein and VPS9 domain-containing protein 1 OS=Bos taurus GN=GAPVD1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.613e-13
Identity = 51/174 (29.31%), Postives = 84/174 (48.28%), Query Frame = 3
Query:  153 RSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFASTSE-DVKIDQEISEKICLLQTFLRPEH--LDIPTFLQNEASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            + I+ FI  F    A  +   + V++F   +  A+    +W NA+ E ++ A   +E+ VM ++F   F    + D+  DQ + E I  L   +   H  L IP     EA W  A+ E++ I+A K PR+KV                 S++    + GADDF+PVL++++IK
Sbjct: 1198 KKIREFIQDFQKLTAADDKTAQ-VEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVMNRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLKEAPWPSAQSEIRTISAYKTPRDKV---QCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIK 1367          
BLAST of DY262455 vs. ExPASy Swiss-Prot
Match: GAPD1_MOUSE (GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus GN=Gapvd1 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 4.692e-13
Identity = 50/174 (28.74%), Postives = 83/174 (47.70%), Query Frame = 3
Query:  153 RSIKSFIVSFSFNNANPENDGKRVQEFFTTMESAIKDHPLWANATIEAIESAMEGLEKYVMTKLFSRTFASTSE-DVKIDQEISEKICLLQTFLRPEH--LDIPTFLQNEASWLLAEKELQKINALKAPREKVXXXXXXXXXXXXXXXXASISENVELGGADDFLPVLIYIIIK 665
            + I+ FI  F    A  +   + V++F   +   +    +W NA+ E ++ A   +E+ VM ++F   F    + D+  DQ + E I  L   +   H  L IP     EA W  A+ E++ I+A K PR+KV                 S++    + GADDF+PVL++++IK
Sbjct: 1243 KKIREFIQDFQKLTAADDKTAQ-VEDFLQFLYGVMAQDVIWQNASEEQLQDAQLAIERSVMNRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSEIRTISAYKTPRDKV---QCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIK 1412          
The following BLAST results are available for this feature:
BLAST of DY262455 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
VPS91_SCHPO6.927e-2226.00Vacuolar protein sorting-associated protein 9a OS=... [more]
VPS9_YEAST2.551e-1728.97Vacuolar protein sorting-associated protein 9 OS=S... [more]
RABX5_BOVIN7.698e-1624.87Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABG... [more]
RABX5_MOUSE1.300e-1540.30Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Ra... [more]
RABX5_HUMAN2.829e-1540.30Rab5 GDP/GTP exchange factor OS=Homo sapiens GN=RA... [more]
GAPD1_XENLA1.235e-1329.65GTPase-activating protein and VPS9 domain-containi... [more]
GAPD1_HUMAN1.613e-1329.31GTPase-activating protein and VPS9 domain-containi... [more]
GAPD1_BOVIN1.613e-1329.31GTPase-activating protein and VPS9 domain-containi... [more]
GAPD1_MOUSE4.692e-1328.74GTPase-activating protein and VPS9 domain-containi... [more]
back to top
Properties
Property NameValue
Genbank descriptionIC0AAA100AB03RM1 CitNFL Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY262455 ID=DY262455|Name=DY262455|organism=Citrus clementina|type=EST|length=1321bp
CCCGCATTTACTTTCCTTTTCGTCAATTTCACCCAAAGCATTTCCAAATG
GACACTTCGTCGTCGTCGTCGGCGTCCGCCGCCGCTCCCTCAGCAGTGAC
CTTCTACGATTTTCTCGATCGCATGCGCAACCCCGCTTCCCTCGATCTCG
TTCGCTCCATCAAAAGCTTCATAGTATCATTTTCATTTAACAATGCGAAC
CCCGAAAATGATGGCAAAAGAGTTCAAGAATTCTTCACGACAATGGAATC
TGCTATTAAAGATCATCCCTTGTGGGCTAATGCCACCATTGAAGCTATTG
AGTCGGCTATGGAGGGTCTGGAGAAATATGTCATGACAAAACTGTTTTCT
CGGACATTTGCATCAACTTCTGAAGATGTGAAGATTGATCAAGAAATTTC
AGAGAAGATATGTTTGCTGCAAACCTTCTTGAGGCCTGAACACTTGGATA
TACCAACGTTTCTTCAAAATGAAGCTTCGTGGCTGCTTGCCGAGAAAGAA
CTGCAGAAGATCAATGCTCTTAAAGCTCCTCGTGAGAAGGTTCTTTGTAT
TATGAATTGTTGCAGGATCATCAACAATTTGCTTCTCAATGCATCTATTT
CGGAAAATGTTGAGCTGGGAGGAGCTGATGACTTTCTTCCCGTCCTAATT
TACATTATCATCAAGCTTCAAGATCAGTTTTGGTCATGTTTGTCGGTATT
ATCTACTTCATGTTCATGCCAATCCTCCTCAGTTGCATTCAAACATCAAA
TTCATTCAGTTGTACCGGAGGCAGGCAATGCTTGTTTCAGAAGCAGCTTA
TTATTTCACAAATCTTGTCTCAGCCAAGACATTTATTCTTGACTTAAATG
CTAAATCACTTTCTATGGAGGAAACTGAGTTTGAGAAAAGTATGCAAGCT
GCAAGATTACCAACAAAGGTACTCTTATTGAAGAATCAACACCTCAAATG
GCATAAAAACCTTAGGAGAGCAGGAACATCCTGAGAGGCATGACGTCACA
CGAATAAAAGCCTTCACCATGTCCAATGACCGAAAATCTTTGGAAGAACA
AAAACCTGGAAGTCCTTCTCAAAAAAAATAACGGCAACAAAAAATTAACA
AAGGGGGGGGTATGGAAACCCCTTTTTAGGGAAACCGAAGGCCGTTCAAT
ATAACACGGGGGGGAAGGTGGGAAAAATTGGTGGAGGGGGGTAAAGGGGA
GGGGGGGAAAAAAAAAATTAAAAAAATCTTGGGGGGGGGGGGGTTTAAAA
ATGGGTCCCGGGGGGGCCCCCCTGGAAAAAGCGTCTCTCTCTTATTTTTT
CCTCCTTTTTTTTTAAGGGGA
back to top