DY258304
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY258304 vs. ExPASy Swiss-Prot
Match: BI1_ARATH (Bax inhibitor 1 OS=Arabidopsis thaliana GN=BI-1 PE=1 SV=1) HSP 1 Score: 44.669 bits (104), Expect = 1.357e-11 Identity = 24/44 (54.55%), Postives = 27/44 (61.36%), Query Frame = 2 Query: 368 GA*IGPLIDPPIPSDLRIQISGFVGTGLAFPCFSEPAMAAMRTE 499 GA +GPLI I D I I+ FVGT +AF CFS AM A R E Sbjct: 101 GASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRRE 144 HSP 2 Score: 34.6538 bits (78), Expect = 1.357e-11 Identity = 16/35 (45.71%), Postives = 22/35 (62.86%), Query Frame = 3 Query: 546 LWLAWASPIFGGPTAILTLESHFELTGFVAYPVMN 650 +WL +AS IFGG +I E +F L FV Y V++ Sbjct: 160 MWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVD 194 HSP 3 Score: 31.5722 bits (70), Expect = 1.357e-11 Identity = 19/49 (38.78%), Postives = 24/49 (48.98%), Query Frame = 1 Query: 664 IHQPHFGHLHYVTPPLTLCQTFVAFFARILKPCPIHPPPKQGNKTKIKN 810 I + H G + YV LTL FVA F RIL + K+ K K +N Sbjct: 199 IEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEEKKKKRRN 247 The following BLAST results are available for this feature:
BLAST of DY258304 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY258304 ID=DY258304; Name=DY258304; organism=Citrus clementina; type=EST; length=1318bpback to top |